Chromatin Immunoprecipitation (ChIP)
(Chromatin Immunoprecipitation (ChIP) Using Hdac4 Antibody - C-terminal region and HCT116 Cells)
Rabbit Hdac4 Polyclonal Antibody | anti-HDAC4 antibody
Hdac4 Antibody - C-terminal region
Gene Names
Hdac4; HD4; 4932408F19Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
Hdac4; Polyclonal Antibody; Hdac4 Antibody - C-terminal region; anti-HDAC4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
Sequence Length
1076
Applicable Applications for anti-HDAC4 antibody
Chromatin IP (ChIP), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 77%; Human: 100%; Mouse: 86%; Rat: 93%; Yeast: 82%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Chromatin Immunoprecipitation (ChIP)
(Chromatin Immunoprecipitation (ChIP) Using Hdac4 Antibody - C-terminal region and HCT116 Cells)
Chromatin Immunoprecipitation (ChIP)
(Chromatin Immunoprecipitation (ChIP) Using Hdac4 Antibody - C-terminal region and HCT116 Cells)
Western Blot (WB)
(Lanes:Lane 1: 40ug mouse brain, synaptosome lysateLane 2: 40ug mouse brain, membrane fractionLane 3: 40ug mouse brain, cytoplasm fractionLane 4: 40ug mouse brain, nuclear fractionLane 5: 40ug mouse brain, post synaptic density fractionLane 6: 40ug mouse brain, synaptosome lysateLane 7: 40ug mouse brain, membrane fractionLane 8: 40ug mouse brain, cytoplasm fractionLane 9: 40ug mouse brain, nuclear fractionPrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:Hdac4Submitted by:Wen-Cheng Xiong, Georgia Health Sciences University)
Western Blot (WB)
(Lanes:Lane 1: 40ug mouse brain, synaptosome lysateLane 2: 40ug mouse brain, membrane fractionLane 3: 40ug mouse brain, cytoplasm fractionLane 4: 40ug mouse brain, nuclear fractionLane 5: 40ug mouse brain, post synaptic density fractionLane 6: 40ug mouse brain, synaptosome lysateLane 7: 40ug mouse brain, membrane fractionLane 8: 40ug mouse brain, cytoplasm fractionLane 9: 40ug mouse brain, nuclear fractionPrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:Hdac4Submitted by:Wen-Cheng Xiong, Georgia Health Sciences University)
Western Blot (WB)
(WB Suggested Anti-Hdac4 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Western Blot (WB)
(WB Suggested Anti-Hdac4 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Related Product Information for anti-HDAC4 antibody
This is a rabbit polyclonal antibody against Hdac4. It was validated on Western Blot
Target Description: Hdac4 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D.
Target Description: Hdac4 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D.
Product Categories/Family for anti-HDAC4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
118kDa
NCBI Official Full Name
histone deacetylase 4
NCBI Official Synonym Full Names
histone deacetylase 4
NCBI Official Symbol
Hdac4
NCBI Official Synonym Symbols
HD4; 4932408F19Rik
NCBI Protein Information
histone deacetylase 4
UniProt Protein Name
Histone deacetylase 4
UniProt Gene Name
Hdac4
UniProt Synonym Gene Names
HD4
Uniprot Description
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D ().
Research Articles on HDAC4
Similar Products
Product Notes
The HDAC4 hdac4 (Catalog #AAA3206954) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hdac4 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Hdac4 can be used in a range of immunoassay formats including, but not limited to, Chromatin IP (ChIP), Western Blot (WB). Researchers should empirically determine the suitability of the HDAC4 hdac4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSTVGHSLIE AQKCEKEEAE TVTAMASLSV GVKPAEKRSE EEPMEEEPPL. It is sometimes possible for the material contained within the vial of "Hdac4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
