Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GZMHSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human GZMH Polyclonal Antibody | anti-GZMH antibody

GZMH Antibody - C-terminal region

Gene Names
GZMH; CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GZMH; Polyclonal Antibody; GZMH Antibody - C-terminal region; anti-GZMH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKD
Sequence Length
246
Applicable Applications for anti-GZMH antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GZMH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GZMHSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GZMHSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GZMH antibody
This is a rabbit polyclonal antibody against GZMH. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the granzyme family. Members of this family are highly conserved serine proteases that eliminate transformed cells and virus-infected cells. This protein, which has chymotrypsin-like activity, has a preference for bulky aromatic amino acids at the P1 position and for acidic residues at the P3' and P4' positions. This protein is reported to be constitutively expressed in NK cells and may play a role in the cytotoxic arm of the innate immune response by inducing target cell death and by directly cleaving substrates in pathogen-infected cells. Alternative splicing results in multiple transcript variants that encode different protein isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
granzyme H isoform 1 preproprotein
NCBI Official Synonym Full Names
granzyme H
NCBI Official Symbol
GZMH
NCBI Official Synonym Symbols
CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2
NCBI Protein Information
granzyme H
UniProt Protein Name
Granzyme H
Protein Family
UniProt Gene Name
GZMH
UniProt Synonym Gene Names
CGL2; CTSGL2; CTSGL2; CSP-C
UniProt Entry Name
GRAH_HUMAN

NCBI Description

This gene encodes a member of the peptidase S1 family of serine proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a chymotrypsin-like protease. This protein is reported to be constitutively expressed in the NK (natural killer) cells of the immune system and may play a role in the cytotoxic arm of the innate immune response by inducing target cell death and by directly cleaving substrates in pathogen-infected cells. This gene is present in a gene cluster with another member of the granzyme subfamily on chromosome 14. [provided by RefSeq, Nov 2015]

Uniprot Description

GZMF: Cytotoxic chymotrypsin-like serine protease with preference for bulky and aromatic residues at the P1 position and acidic residues at the P3' and P4' sites. Probably necessary for target cell lysis in cell-mediated immune responses. Belongs to the peptidase S1 family. Granzyme subfamily.

Protein type: EC 3.4.21.-; Protease

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: membrane; intracellular membrane-bound organelle; cytoplasm

Molecular Function: serine-type endopeptidase activity

Biological Process: apoptosis; cytolysis; immune response; protein processing; proteolysis

Research Articles on GZMH

Similar Products

Product Notes

The GZMH gzmh (Catalog #AAA3219458) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GZMH Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GZMH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GZMH gzmh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVLLTVQKDC QCERLFHGNY SRATEICVGD PKKTQTGFKG DSGGPLVCKD. It is sometimes possible for the material contained within the vial of "GZMH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.