Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GTF2H1Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GTF2H1 Polyclonal Antibody | anti-GTF2H1 antibody

GTF2H1 Antibody - middle region

Gene Names
GTF2H1; P62; BTF2; TFB1; TFIIH
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GTF2H1; Polyclonal Antibody; GTF2H1 Antibody - middle region; anti-GTF2H1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEME
Sequence Length
548
Applicable Applications for anti-GTF2H1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GTF2H1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GTF2H1Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GTF2H1Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GTF2H1 antibody
Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.
Product Categories/Family for anti-GTF2H1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
general transcription factor IIH subunit 1
NCBI Official Synonym Full Names
general transcription factor IIH subunit 1
NCBI Official Symbol
GTF2H1
NCBI Official Synonym Symbols
P62; BTF2; TFB1; TFIIH
NCBI Protein Information
general transcription factor IIH subunit 1
UniProt Protein Name
General transcription factor IIH subunit 1
UniProt Gene Name
GTF2H1
UniProt Synonym Gene Names
BTF2; BTF2 p62
UniProt Entry Name
TF2H1_HUMAN

Uniprot Description

GTF2H1: Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.

Protein type: Transcription initiation complex

Chromosomal Location of Human Ortholog: 11p15.1-p14

Cellular Component: nucleoplasm; holo TFIIH complex

Molecular Function: RNA polymerase subunit kinase activity; DNA-dependent ATPase activity; protein binding; protein kinase activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; positive regulation of viral transcription; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; termination of RNA polymerase I transcription; DNA repair; protein amino acid phosphorylation; regulation of gene expression, epigenetic; mRNA capping; nucleotide-excision repair; negative regulation of gene expression, epigenetic; transcription-coupled nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; gene expression; nucleotide-excision repair, DNA damage removal; positive regulation of transcription from RNA polymerase II promoter; regulation of cyclin-dependent protein kinase activity; transcription initiation from RNA polymerase I promoter

Research Articles on GTF2H1

Similar Products

Product Notes

The GTF2H1 gtf2h1 (Catalog #AAA3224273) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTF2H1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2H1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GTF2H1 gtf2h1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGKNNSVKTI ALNLKKSDRY YHGPTPIQSL QYATSQDIIN SFQSIRQEME. It is sometimes possible for the material contained within the vial of "GTF2H1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.