Rabbit anti-Human, Mouse GSTP1 Polyclonal Antibody | anti-GSTP1 antibody

GSTP1 (Glutathione S-transferase P, GST Class-pi, GSTP1-1, FAEES3, GST3) (FITC)

Cat. Num. AAA6380454

• Gene Names: GSTP1; PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSTP1; Polyclonal Antibody; GSTP1 (Glutathione S-transferase P; GST Class-pi; GSTP1-1; FAEES3; GST3) (FITC); anti-GSTP1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GSTP1. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
• Sequence Length: 773

• Applicable Applications for anti-GSTP1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GSTP1, aa1-210 (AAH10915.1).
• Immunogen Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GSTP1 rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in human kidney.)

Western Blot (WB)

(GSTP1 rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in mouse liver.)

Western Blot (WB)

(GSTP1 rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of GSTP1 expression in transfected 293T cell line by GSTP1 polyclonal antibody. Lane 1: GSTP1 transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GSTP1 and MAPK8 HeLa cells were stained with GSTP1 rabbit purified polyclonal 1:1200 and MAPK8 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-GSTP1 antibody

Human glutathione S-transferases (GSTs) are a large multigene family of isoenzymes, which catalyse the conjugation of glutathione to electrophilic substrates. These enzymes are involved in the detoxification of both endogenous and exogenous electrophiles, which can react with cellular components such as DNA. The modification of DNA by reactive compounds can initiate carcinogenesis and the GSTs are believed to play a role in cancer prevention by inactivating carcinogens. There are four major structural classes of mammalian cytosolic GSTs (alpha, mu, pi and theta).

Product Categories/Family for anti-GSTP1 antibody

Antibodies; Epitope Tag; GST

NCBI and Uniprot Product Information

• NCBI GI #: 15012035
• NCBI GeneID: 2950
• NCBI Official Full Name: Homo sapiens glutathione S-transferase pi 1, mRNA
• NCBI Official Synonym Full Names: glutathione S-transferase pi 1
• NCBI Official Symbol: GSTP1
• NCBI Official Synonym Symbols: PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22
• NCBI Protein Information: glutathione S-transferase P
• Protein Family: Glutathione S-transferase

NCBI Description

Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq, Jul 2008]