Mouse anti-Human GSTP1 Monoclonal Antibody | anti-GSTP1 antibody

GSTP1 (Glutathione S-transferase P, GST Class-pi, GSTP1-1, FAEES3, GST3) (AP)

Cat. Num. AAA6131584

• Gene Names: GSTP1; PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography
• Synonyms: GSTP1; Monoclonal Antibody; GSTP1 (Glutathione S-transferase P; GST Class-pi; GSTP1-1; FAEES3; GST3) (AP); anti-GSTP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G6-F6
• Specificity: Recognizes human GSTP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-GSTP1 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-210 from human GSTP1 (AAH10915) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (48.84kD).)

Western Blot (WB)

(Western Blot analysis of GSTP1 expression in transfected 293T cell line by GSTP1 monoclonal antibody. Lane 1: GSTP1 transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GSTP1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of GSTP1 transfected lysate using GSTP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GSTP1 rabbit polyclonal antibody.)

Product Categories/Family for anti-GSTP1 antibody

Antibodies; Epitope Tag; GST

References

1. Endothelial cell dysfunction and cytoskeletal changes associated with repression of p16(INK4a) during immortalization. Kan CY, Wen VW, Pasquier E, Jankowski K, Chang M, Richards LA, Kavallaris M, Mackenzie KL.Oncogene. 2012 Feb 6. doi: 10.1038/onc.2011.645.

NCBI and Uniprot Product Information

• NCBI GI #: 15012035
• NCBI GeneID: 2950
• Molecular Weight: 23,356 Da
• NCBI Official Full Name: Homo sapiens glutathione S-transferase pi 1, mRNA
• NCBI Official Synonym Full Names: glutathione S-transferase pi 1
• NCBI Official Symbol: GSTP1
• NCBI Official Synonym Symbols: PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22
• NCBI Protein Information: glutathione S-transferase P
• Protein Family: Glutathione S-transferase

NCBI Description

Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq, Jul 2008]