Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GSTP1 rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in human kidney.)

Rabbit anti-Human, Mouse GSTP1 Polyclonal Antibody | anti-GSTP1 antibody

GSTP1 (Glutathione S-transferase P, GST Class-pi, GSTP1-1, FAEES3, GST3) APC

Gene Names
GSTP1; PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSTP1; Polyclonal Antibody; GSTP1 (Glutathione S-transferase P; GST Class-pi; GSTP1-1; FAEES3; GST3) APC; anti-GSTP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GSTP1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
773
Applicable Applications for anti-GSTP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GSTP1, aa1-210 (AAH10915.1).
Immunogen Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GSTP1 rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in human kidney.)

Western Blot (WB) (GSTP1 rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in human kidney.)

Western Blot (WB)

(GSTP1 rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in mouse liver.)

Western Blot (WB) (GSTP1 rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in mouse liver.)

Western Blot (WB)

(GSTP1 rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in HeLa.)

Western Blot (WB) (GSTP1 rabbit polyclonal antibody. Western Blot analysis of GSTP1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of GSTP1 expression in transfected 293T cell line by GSTP1 polyclonal antibody. Lane 1: GSTP1 transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GSTP1 expression in transfected 293T cell line by GSTP1 polyclonal antibody. Lane 1: GSTP1 transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GSTP1 and MAPK8 HeLa cells were stained with GSTP1 rabbit purified polyclonal 1:1200 and MAPK8 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GSTP1 and MAPK8 HeLa cells were stained with GSTP1 rabbit purified polyclonal 1:1200 and MAPK8 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-GSTP1 antibody
Human glutathione S-transferases (GSTs) are a large multigene family of isoenzymes, which catalyse the conjugation of glutathione to electrophilic substrates. These enzymes are involved in the detoxification of both endogenous and exogenous electrophiles, which can react with cellular components such as DNA. The modification of DNA by reactive compounds can initiate carcinogenesis and the GSTs are believed to play a role in cancer prevention by inactivating carcinogens. There are four major structural classes of mammalian cytosolic GSTs (alpha, mu, pi and theta).
Product Categories/Family for anti-GSTP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens glutathione S-transferase pi 1, mRNA
NCBI Official Synonym Full Names
glutathione S-transferase pi 1
NCBI Official Symbol
GSTP1
NCBI Official Synonym Symbols
PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22
NCBI Protein Information
glutathione S-transferase P
Protein Family

NCBI Description

Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq, Jul 2008]

Research Articles on GSTP1

Similar Products

Product Notes

The GSTP1 (Catalog #AAA6380452) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSTP1 (Glutathione S-transferase P, GST Class-pi, GSTP1-1, FAEES3, GST3) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GSTP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSTP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSTP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.