Rabbit GSTM1 Polyclonal Antibody | anti-GSTM1 antibody

Anti-GSTM1 Picoband antibody

Cat. Num. AAA1750436

• Gene Names: GSTM1; MU; H-B; GST1; GTH4; GTM1; MU-1; GSTM1-1; GSTM1a-1a; GSTM1b-1b
• Reactivity: Mouse, Rat; Predicted Reactivity: Human; No cross reactivity with other proteins.
• Applications: Western Blot
• Synonyms: GSTM1; Polyclonal Antibody; Anti-GSTM1 Picoband antibody; Glutathione S-transferase Mu 1; GST HB subunit 4; GST class-mu 1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4; GST1; anti-GSTM1 antibody

• Host: Rabbit
• Reactivity: Mouse, Rat; Predicted Reactivity: Human; No cross reactivity with other proteins.
• Clonality: Polyclonal
• Form/Format: Lyophilized
• Sequence Length: 181

• Applicable Applications for anti-GSTM1 antibody: Western Blot (WB)
• Application Notes: WB: 0.1-0.5mug/ml
• Immunogen: A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK).
• Subcellular Localization: Cytoplasm.
• Tissue Specificity: Liver (at protein level).
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of GSTM1 using anti-GSTM1 antibody (MBS1750436). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat brain tissue lysates,Lane 2: rat lung tissue lysates,Lane 3: mouse stomach tissue lysates,Lane 4: mouse kidney tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GSTM1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GSTM1 at approximately 26KD. The expected band size for GSTM1 is at 26KD. )

Related Product Information for anti-GSTM1 antibody

Description: Glutathione S-transferase Mu 1 (gene name GSTM1) is a human glutathione S-transferase. Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene.
Protein Function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Product Categories/Family for anti-GSTM1 antibody

Tags & Cell Markers; Cell Type Markers; Tumor Associated; Signal Transduction; Metabolism; Drug Metabolism; Metabolism; Pathways and Processes; Metabolic Signaling Pathways; Types of Disease; Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 23065544
• NCBI GeneID: 2944
• NCBI Accession #: NP_000552.2
• NCBI GenBank Nucleotide #: NM_000561.3
• UniProt Accession #: P09488; Q5GHG0; Q6FH88; Q8TC98; Q9UC96
• Molecular Weight: 21,253 Da
• NCBI Official Full Name: glutathione S-transferase Mu 1 isoform 1
• NCBI Official Synonym Full Names: glutathione S-transferase mu 1
• NCBI Official Symbol: GSTM1
• NCBI Official Synonym Symbols: MU; H-B; GST1; GTH4; GTM1; MU-1; GSTM1-1; GSTM1a-1a; GSTM1b-1b
• NCBI Protein Information: glutathione S-transferase Mu 1
• UniProt Protein Name: Glutathione S-transferase Mu 1
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTM1
• UniProt Synonym Gene Names: GST1

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.