Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KCRBSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CKB Polyclonal Antibody | anti-CKB antibody

CKB Antibody - N-terminal region

Gene Names
CKB; BCK; B-CK; CKBB; CPK-B; HEL-211; HEL-S-29
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CKB; Polyclonal Antibody; CKB Antibody - N-terminal region; anti-CKB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD
Sequence Length
381
Applicable Applications for anti-CKB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCRB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KCRBSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KCRBSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CKB antibody
This is a rabbit polyclonal antibody against KCRB. It was validated on Western Blot

Target Description: The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized.
Product Categories/Family for anti-CKB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
creatine kinase B-type isoform 1
NCBI Official Synonym Full Names
creatine kinase B
NCBI Official Symbol
CKB
NCBI Official Synonym Symbols
BCK; B-CK; CKBB; CPK-B; HEL-211; HEL-S-29
NCBI Protein Information
creatine kinase B-type
UniProt Protein Name
Creatine kinase B-type
Protein Family
UniProt Gene Name
CKB
UniProt Synonym Gene Names
CKBB
UniProt Entry Name
KCRB_HUMAN

NCBI Description

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

CKB: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. Belongs to the ATP:guanido phosphotransferase family.

Protein type: Amino Acid Metabolism - arginine and proline; EC 2.7.3.2; Kinase, other

Chromosomal Location of Human Ortholog: 14q32

Cellular Component: mitochondrion; cytosol

Molecular Function: protein binding; creatine kinase activity; ATP binding

Biological Process: substantia nigra development; phosphorylation; creatine metabolic process; cellular chloride ion homeostasis

Research Articles on CKB

Similar Products

Product Notes

The CKB ckb (Catalog #AAA3220200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CKB Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CKB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CKB ckb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVGCVAGDEE SYEVFKDLFD PIIEDRHGGY KPSDEHKTDL NPDNLQGGDD. It is sometimes possible for the material contained within the vial of "CKB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.