Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse GSTA4 Polyclonal Antibody | anti-GSTA4 antibody

GSTA4 (Glutathione S-transferase A4, GST Class-alpha Member 4, Glutathione S-transferase A4-4, DKFZp686D21185) (MaxLight 550)

Gene Names
GSTA4; GTA4; GSTA4-4
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSTA4; Polyclonal Antibody; GSTA4 (Glutathione S-transferase A4; GST Class-alpha Member 4; Glutathione S-transferase A4-4; DKFZp686D21185) (MaxLight 550); anti-GSTA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GSTA4. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-GSTA4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa 1-222 from human GSTA4 (NP_001503.1).
Immunogen Sequence
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GSTA4 antibody
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).
Product Categories/Family for anti-GSTA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,884 Da
NCBI Official Full Name
glutathione S-transferase A4
NCBI Official Synonym Full Names
glutathione S-transferase alpha 4
NCBI Official Symbol
GSTA4
NCBI Official Synonym Symbols
GTA4; GSTA4-4
NCBI Protein Information
glutathione S-transferase A4; GST class-alpha member 4; S-(hydroxyalkyl)glutathione lyase A4; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A4; glutathione S-aryltransferase A4; glutathione S-transferase A4-4; glutathione transferase
UniProt Protein Name
Glutathione S-transferase A4
Protein Family
UniProt Gene Name
GSTA4
UniProt Entry Name
GSTA4_HUMAN

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq, Jul 2008]

Uniprot Description

GSTA4: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4- hydroxynonenal (4-HNE). Belongs to the GST superfamily. Alpha family.

Protein type: Xenobiotic Metabolism - drug metabolism - cytochrome P450; Other Amino Acids Metabolism - glutathione; Xenobiotic Metabolism - metabolism by cytochrome P450; Transferase; EC 2.5.1.18

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: cytosol

Molecular Function: protein homodimerization activity; glutathione transferase activity

Biological Process: glutathione metabolic process; xenobiotic metabolic process

Research Articles on GSTA4

Similar Products

Product Notes

The GSTA4 gsta4 (Catalog #AAA6380392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSTA4 (Glutathione S-transferase A4, GST Class-alpha Member 4, Glutathione S-transferase A4-4, DKFZp686D21185) (MaxLight 550) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GSTA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSTA4 gsta4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSTA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.