Rabbit anti-Human, Mouse GSTA4 Polyclonal Antibody | anti-GSTA4 antibody

GSTA4 (Glutathione S-transferase A4, GST Class-alpha Member 4, Glutathione S-transferase A4-4, DKFZp686D21185) (FITC)

Cat. Num. AAA6380388

• Gene Names: GSTA4; GTA4; GSTA4-4
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSTA4; Polyclonal Antibody; GSTA4 (Glutathione S-transferase A4; GST Class-alpha Member 4; Glutathione S-transferase A4-4; DKFZp686D21185) (FITC); anti-GSTA4 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GSTA4. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-GSTA4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GSTA4, aa1-222 (NP_001503.1).
• Immunogen Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GSTA4 rabbit polyclonal antibody. Western Blot analysis of GSTA4 expression in human placenta.)

Western Blot (WB)

(127593. Western Blot analysis of GSTA4 expression in mouse spleen.)

Western Blot (WB)

(127593. Western Blot analysis of GSTA4 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of GSTA4 expression in transfected 293T cell line by 127593. Lane 1: GSTA4 transfected lysate (25.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-GSTA4 antibody

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).

Product Categories/Family for anti-GSTA4 antibody

Antibodies; Epitope Tag; GST

NCBI and Uniprot Product Information

• NCBI GI #: 4504173
• NCBI GeneID: 2941
• NCBI Accession #: NP_001503.1
• NCBI GenBank Nucleotide #: NM_001512.2
• UniProt Accession #: O15217; Q5T7Q8; Q6P4G1; Q9BX18; Q9H414; B2RD15
• Molecular Weight: 14,884 Da
• NCBI Official Full Name: glutathione S-transferase A4
• NCBI Official Synonym Full Names: glutathione S-transferase alpha 4
• NCBI Official Symbol: GSTA4
• NCBI Official Synonym Symbols: GTA4; GSTA4-4
• NCBI Protein Information: glutathione S-transferase A4; GST class-alpha member 4; S-(hydroxyalkyl)glutathione lyase A4; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A4; glutathione S-aryltransferase A4; glutathione S-transferase A4-4; glutathione transferase
• UniProt Protein Name: Glutathione S-transferase A4
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTA4
• UniProt Entry Name: GSTA4_HUMAN

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq, Jul 2008]

Uniprot Description

GSTA4: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4- hydroxynonenal (4-HNE). Belongs to the GST superfamily. Alpha family.

Protein type: Xenobiotic Metabolism - drug metabolism - cytochrome P450; Other Amino Acids Metabolism - glutathione; Xenobiotic Metabolism - metabolism by cytochrome P450; Transferase; EC 2.5.1.18

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: cytosol

Molecular Function: protein homodimerization activity; glutathione transferase activity

Biological Process: glutathione metabolic process; xenobiotic metabolic process