Western Blot (WB)
(WB Suggested Anti-Stxbp6 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)
Rabbit Stxbp6 Polyclonal Antibody | anti-STXBP6 antibody
Stxbp6 antibody - N-terminal region
Gene Names
Stxbp6; C85317; BC024598
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Stxbp6; Polyclonal Antibody; Stxbp6 antibody - N-terminal region; anti-STXBP6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SAISKEIFAPLDERMLGAIQVKRRTKKKIPFLATGGQGEYLTYICLSVTN
Sequence Length
210
Applicable Applications for anti-STXBP6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Stxbp6 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)
Western Blot (WB)
(WB Suggested Anti-Stxbp6 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)
Related Product Information for anti-STXBP6 antibody
This is a rabbit polyclonal antibody against Stxbp6. It was validated on Western Blot
Target Description: Stxbp6 forms non-fusogenic complexes with SNAP25 and STX1A and may thereby modulate the formation of functional SNARE complexes and exocytosis.
Target Description: Stxbp6 forms non-fusogenic complexes with SNAP25 and STX1A and may thereby modulate the formation of functional SNARE complexes and exocytosis.
Product Categories/Family for anti-STXBP6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
syntaxin-binding protein 6
NCBI Official Synonym Full Names
syntaxin binding protein 6 (amisyn)
NCBI Official Symbol
Stxbp6
NCBI Official Synonym Symbols
C85317; BC024598
NCBI Protein Information
syntaxin-binding protein 6
UniProt Protein Name
Syntaxin-binding protein 6
Protein Family
UniProt Gene Name
Stxbp6
UniProt Entry Name
STXB6_MOUSE
Research Articles on STXBP6
Similar Products
Product Notes
The STXBP6 stxbp6 (Catalog #AAA3211983) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Stxbp6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Stxbp6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STXBP6 stxbp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SAISKEIFAP LDERMLGAIQ VKRRTKKKIP FLATGGQGEY LTYICLSVTN. It is sometimes possible for the material contained within the vial of "Stxbp6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
