Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type :Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: GFP Red: NR2a Yellow: VGLUT12Gene Name :GRIN2ASubmitted by :Dan Fowler - University of Oregon, Institute of Neuroscience)

Rabbit GRIN2A Polyclonal Antibody | anti-GRIN2A antibody

GRIN2A antibody - middle region

Gene Names
GRIN2A; LKS; EPND; FESD; NR2A; GluN2A; NMDAR2A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GRIN2A; Polyclonal Antibody; GRIN2A antibody - middle region; anti-GRIN2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
Sequence Length
1464
Applicable Applications for anti-GRIN2A antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 77%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GRIN2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: GFP Red: NR2a Yellow: VGLUT12Gene Name :GRIN2ASubmitted by :Dan Fowler - University of Oregon, Institute of Neuroscience)

Immunohistochemistry (IHC) (Sample Type :Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: GFP Red: NR2a Yellow: VGLUT12Gene Name :GRIN2ASubmitted by :Dan Fowler - University of Oregon, Institute of Neuroscience)

Western Blot (WB)

(WB Suggested Anti-GRIN2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-GRIN2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-GRIN2A antibody
This is a rabbit polyclonal antibody against GRIN2A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate-gated ion channels. These receptors have been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C) and NMDAR2D (GRIN2D).N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
163kDa
NCBI Official Full Name
glutamate receptor ionotropic, NMDA 2A isoform 1
NCBI Official Synonym Full Names
glutamate ionotropic receptor NMDA type subunit 2A
NCBI Official Symbol
GRIN2A
NCBI Official Synonym Symbols
LKS; EPND; FESD; NR2A; GluN2A; NMDAR2A
NCBI Protein Information
glutamate receptor ionotropic, NMDA 2A
UniProt Protein Name
Glutamate receptor ionotropic, NMDA 2A
UniProt Gene Name
GRIN2A
UniProt Synonym Gene Names
NMDAR2A; GluN2A; NMDAR2A; NR2A; hNR2A
UniProt Entry Name
NMDE1_HUMAN

NCBI Description

This gene encodes a member of the glutamate-gated ion channel protein family. The encoded protein is an N-methyl-D-aspartate (NMDA) receptor subunit. NMDA receptors are both ligand-gated and voltage-dependent, and are involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. These receptors are permeable to calcium ions, and activation results in a calcium influx into post-synaptic cells, which results in the activation of several signaling cascades. Disruption of this gene is associated with focal epilepsy and speech disorder with or without cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

NMDAR2A: a subunit of N-methyl-D-aspartate (NMDA) receptors, members of the glutamate receptor channel superfamily. Possesses high calcium permeability and voltage-dependent sensitivity to magnesium and is modulated by glycine. Plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. Mediates neuronal functions in glutamate neurotransmission.

Protein type: Channel, ligand-gated; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p13.2

Cellular Component: presynaptic membrane; postsynaptic membrane; synaptic vesicle; cell surface; endoplasmic reticulum; integral to plasma membrane; dendrite; plasma membrane; cell junction; N-methyl-D-aspartate selective glutamate receptor complex

Molecular Function: protein binding; extracellular-glutamate-gated ion channel activity; zinc ion binding; N-methyl-D-aspartate selective glutamate receptor activity; calcium channel activity

Biological Process: startle response; positive regulation of apoptosis; regulation of synaptic plasticity; sensory perception of pain; dopamine metabolic process; synaptic transmission; protein localization; learning and/or memory; transport; response to wounding; visual learning; serotonin metabolic process; response to drug; synaptic transmission, glutamatergic; glutamate signaling pathway; response to amphetamine; sleep; memory; response to ethanol; neurogenesis; directional locomotion; ionotropic glutamate receptor signaling pathway; regulation of sensory perception of pain; negative regulation of protein catabolic process; regulation of excitatory postsynaptic membrane potential

Disease: Epilepsy, Focal, With Speech Disorder And With Or Without Mental Retardation

Research Articles on GRIN2A

Similar Products

Product Notes

The GRIN2A grin2a (Catalog #AAA3202400) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRIN2A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRIN2A can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GRIN2A grin2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DKIYTIDGEK EPGFHLDPPQ FVENVTLPEN VDFPDPYQDP SENFRKGDST. It is sometimes possible for the material contained within the vial of "GRIN2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.