Rabbit GPX3 Polyclonal Antibody | anti-GPX3 antibody

GPX3 antibody - N-terminal region

Cat. Num. AAA3205883

• Gene Names: GPX3; GPx-P; GSHPx-3; GSHPx-P
• Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: GPX3; Polyclonal Antibody; GPX3 antibody - N-terminal region; anti-GPX3 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
• Sequence Length: 226

• Applicable Applications for anti-GPX3 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 100%; Dog: 83%; Guinea Pig: 79%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPX3
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-GPX3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Membrane and cytoplasmic in alveolar type I & II cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-GPX3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateGPX3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Related Product Information for anti-GPX3 antibody

This is a rabbit polyclonal antibody against GPX3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme. GPX3 expression appears to be tissue-specific.

Product Categories/Family for anti-GPX3 antibody

Polyclonal; Signal Proteins; Drugs and Drug Metabolism; Tissue Specific & Cell Marker

NCBI and Uniprot Product Information

• NCBI GI #: 6006001
• NCBI GeneID: 2878
• NCBI Accession #: NP_002075
• NCBI GenBank Nucleotide #: NM_002084
• UniProt Accession #: P22352
• Molecular Weight: 25kDa
• NCBI Official Full Name: glutathione peroxidase 3 isoform 1
• NCBI Official Synonym Full Names: glutathione peroxidase 3
• NCBI Official Symbol: GPX3
• NCBI Official Synonym Symbols: GPx-P; GSHPx-3; GSHPx-P
• NCBI Protein Information: glutathione peroxidase 3
• UniProt Protein Name: Glutathione peroxidase 3
• Protein Family: Probable glutathione peroxidase
• UniProt Gene Name: GPX3
• UniProt Synonym Gene Names: GPXP; GPx-3; GSHPx-3; GPx-P; GSHPx-P
• UniProt Entry Name: GPX3_HUMAN

NCBI Description

The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is secreted, and is abundantly found in plasma. Downregulation of expression of this gene by promoter hypermethylation has been observed in a wide spectrum of human malignancies, including thyroid cancer, hepatocellular carcinoma and chronic myeloid leukemia. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2016]

Uniprot Description

GPX3: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. Belongs to the glutathione peroxidase family.

Protein type: EC 1.11.1.9; Secreted; Lipid Metabolism - arachidonic acid; Secreted, signal peptide; Oxidoreductase; Other Amino Acids Metabolism - glutathione

Chromosomal Location of Human Ortholog: 5q33.1

Cellular Component: extracellular space; extracellular region

Molecular Function: selenium binding; glutathione peroxidase activity; transcription factor binding

Biological Process: response to reactive oxygen species; response to lipid hydroperoxide; hydrogen peroxide catabolic process; protein homotetramerization