Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GPRC5CSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human GPRC5C Polyclonal Antibody | anti-GPRC5C antibody

GPRC5C Antibody - C-terminal region

Gene Names
GPRC5C; RAIG3; RAIG-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPRC5C; Polyclonal Antibody; GPRC5C Antibody - C-terminal region; anti-GPRC5C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVF
Sequence Length
441
Applicable Applications for anti-GPRC5C antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPRC5C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GPRC5CSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GPRC5CSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GPRC5C antibody
This is a rabbit polyclonal antibody against GPRC5C. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-GPRC5C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
G-protein coupled receptor family C group 5 member C isoform b
NCBI Official Synonym Full Names
G protein-coupled receptor class C group 5 member C
NCBI Official Symbol
GPRC5C
NCBI Official Synonym Symbols
RAIG3; RAIG-3
NCBI Protein Information
G-protein coupled receptor family C group 5 member C
UniProt Protein Name
G-protein coupled receptor family C group 5 member C
UniProt Gene Name
GPRC5C
UniProt Synonym Gene Names
RAIG3; RAIG-3
UniProt Entry Name
GPC5C_HUMAN

NCBI Description

The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GPRC5C: This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways. Belongs to the G-protein coupled receptor 3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 3; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: cytoplasmic vesicle membrane; mitochondrion; integral to plasma membrane; receptor complex; vesicle

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway

Research Articles on GPRC5C

Similar Products

Product Notes

The GPRC5C gprc5c (Catalog #AAA3217248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPRC5C Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPRC5C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPRC5C gprc5c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GAYDIILPRA TANSQVMGSA NSTLRAEDMY SAQSHQAATP PKDGKNSQVF. It is sometimes possible for the material contained within the vial of "GPRC5C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.