Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GPRC5B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Rabbit GPRC5B Polyclonal Antibody | anti-GPRC5B antibody

GPRC5B antibody - N-terminal region

Gene Names
GPRC5B; RAIG2; RAIG-2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPRC5B; Polyclonal Antibody; GPRC5B antibody - N-terminal region; anti-GPRC5B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLT
Sequence Length
403
Applicable Applications for anti-GPRC5B antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 77%; Pig: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GPRC5B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GPRC5B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-GPRC5B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-GPRC5B antibody
This is a rabbit polyclonal antibody against GPRC5B. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade.
Product Categories/Family for anti-GPRC5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
G-protein coupled receptor family C group 5 member B isoform 1
NCBI Official Synonym Full Names
G protein-coupled receptor class C group 5 member B
NCBI Official Symbol
GPRC5B
NCBI Official Synonym Symbols
RAIG2; RAIG-2
NCBI Protein Information
G-protein coupled receptor family C group 5 member B
UniProt Protein Name
G-protein coupled receptor family C group 5 member B
UniProt Gene Name
GPRC5B
UniProt Synonym Gene Names
RAIG2; RAIG-2
UniProt Entry Name
GPC5B_HUMAN

NCBI Description

This gene encodes a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The encoded protein may modulate insulin secretion and increased protein expression is associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]

Uniprot Description

GPRC5B: Unknown. This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways. Belongs to the G-protein coupled receptor 3 family.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 3

Chromosomal Location of Human Ortholog: 16p12

Cellular Component: extracellular space; cell surface; cytoplasmic vesicle membrane; intracellular membrane-bound organelle; nucleolus; plasma membrane; integral to membrane; nucleus; lipid raft

Molecular Function: G-protein coupled receptor activity; G-protein-coupled receptor binding; protein kinase activator activity; protein kinase binding

Biological Process: G-protein coupled receptor protein signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; locomotory behavior; positive regulation of neuron differentiation; glucose homeostasis; positive regulation of inflammatory response

Research Articles on GPRC5B

Similar Products

Product Notes

The GPRC5B gprc5b (Catalog #AAA3214515) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPRC5B antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's GPRC5B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPRC5B gprc5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVAGAGALIT LLLMLILLVR LPFIKEKEKK SPVGLHFLFL LGTLGLFGLT. It is sometimes possible for the material contained within the vial of "GPRC5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.