Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RAI3Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human GPRC5A Polyclonal Antibody | anti-GPRC5A antibody

GPRC5A Antibody - C-terminal region

Gene Names
GPRC5A; RAI3; TIG1; RAIG1; GPCR5A; PEIG-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GPRC5A; Polyclonal Antibody; GPRC5A Antibody - C-terminal region; anti-GPRC5A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Sequence Length
357
Applicable Applications for anti-GPRC5A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAI3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RAI3Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RAI3Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GPRC5A antibody
This is a rabbit polyclonal antibody against RAI3. It was validated on Western Blot

Target Description: This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
retinoic acid-induced protein 3
NCBI Official Synonym Full Names
G protein-coupled receptor class C group 5 member A
NCBI Official Symbol
GPRC5A
NCBI Official Synonym Symbols
RAI3; TIG1; RAIG1; GPCR5A; PEIG-1
NCBI Protein Information
retinoic acid-induced protein 3
UniProt Protein Name
Retinoic acid-induced protein 3
UniProt Gene Name
GPRC5A
UniProt Synonym Gene Names
GPCR5A; RAI3; RAIG1; RAIG-1
UniProt Entry Name
RAI3_HUMAN

NCBI Description

This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

RAIG1: a G protein coupled receptor that is induced by all-trans retinoic acid (ATRA). Retinoic acids (RA) are a group of pleiotropic signaling molecules that regulate a broad range of physiologic and developmental processes. RAIG1 is expressed in lung tissue and in several lung cancer cell lines. This retinoic acid-inducible GPCR provides evidence for an interaction between retinoid and G-protein signaling pathways.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 3

Chromosomal Location of Human Ortholog: 12p13.1

Cellular Component: cytoplasmic vesicle membrane; intracellular membrane-bound organelle; integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; signal transduction

Research Articles on GPRC5A

Similar Products

Product Notes

The GPRC5A gprc5a (Catalog #AAA3219965) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPRC5A Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPRC5A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPRC5A gprc5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFEETGDTLY APYSTHFQLQ NQPPQKEFSI PRAHAWPSPY KDYEVKKEGS. It is sometimes possible for the material contained within the vial of "GPRC5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.