Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WLSSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

Rabbit GPR177 Polyclonal Antibody | anti-WLS antibody

GPR177 antibody - middle region

Gene Names
WLS; EVI; MRP; GPR177; mig-14; C1orf139
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPR177; Polyclonal Antibody; GPR177 antibody - middle region; anti-WLS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE
Sequence Length
543
Applicable Applications for anti-WLS antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GPR177
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WLSSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: WLSSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-GPR177 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-GPR177 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Related Product Information for anti-WLS antibody
This is a rabbit polyclonal antibody against GPR177. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GPR177 has signal transducer activity. It is positive regulation of I-kappaB kinase/NF-kappaB cascade.
Product Categories/Family for anti-WLS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
protein wntless homolog isoform 2
NCBI Official Synonym Full Names
Wnt ligand secretion mediator
NCBI Official Symbol
WLS
NCBI Official Synonym Symbols
EVI; MRP; GPR177; mig-14; C1orf139
NCBI Protein Information
protein wntless homolog
UniProt Protein Name
Protein wntless homolog
Protein Family
UniProt Gene Name
WLS
UniProt Synonym Gene Names
C1orf139; GPR177; EVI
UniProt Entry Name
WLS_HUMAN

Uniprot Description

GPR177: Regulates Wnt proteins sorting and secretion in a feedback regulatory mechanism. This reciprocal interaction plays a key role in the regulation of expression, subcellular location, binding and organelle-specific association of Wnt proteins. Plays also an important role in establishment of the anterior-posterior body axis formation during development. Belongs to the wntless family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: dendrite cytoplasm; Golgi membrane; cytoplasmic vesicle membrane; early endosome membrane; integral to membrane; plasma membrane

Molecular Function: Wnt-protein binding; signal transducer activity; protein binding; mu-type opioid receptor binding

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; Wnt receptor signaling pathway; mesoderm formation; anterior/posterior axis specification

Research Articles on WLS

Similar Products

Product Notes

The WLS wls (Catalog #AAA3207366) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR177 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GPR177 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WLS wls for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DIRLVGIHQN GGFTKVWFAM KTFLTPSIFI IMVWYWRRIT MMSRPPVLLE. It is sometimes possible for the material contained within the vial of "GPR177, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.