Western Blot (WB)
(Western blot-IFNA21 Polyclonal Antibody)
Rabbit anti-Mouse IFNA21 Polyclonal Antibody | anti-IFNA21 antibody
IFNA21 Polyclonal Antibody
Gene Names
IFNA21; LeIF F; leIF-F; IFN-alphaI
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
IFNA21; Polyclonal Antibody; IFNA21 Polyclonal Antibody; IFN-alphaI; LeIF F; leIF-F; interferon alpha-21; anti-IFNA21 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.47 mg/ml (varies by lot)
Sequence Length
189
Applicable Applications for anti-IFNA21 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human IFNA21 (NP_002166.2).
Immunogen Sequence
WEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-IFNA21 Polyclonal Antibody)
Western Blot (WB)
(Western blot-IFNA21 Polyclonal Antibody)
Related Product Information for anti-IFNA21 antibody
This gene is a member of the alpha interferon gene cluster on the short arm of chromosome 9. Interferons are cytokines produced in response to viral infection that mediate the immune response and interfere with viral replication. The encoded protein is a type I interferon and may play a specific role in the antiviral response to rubella virus.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interferon alpha-21
NCBI Official Synonym Full Names
interferon alpha 21
NCBI Official Symbol
IFNA21
NCBI Official Synonym Symbols
LeIF F; leIF-F; IFN-alphaI
NCBI Protein Information
interferon alpha-21
UniProt Protein Name
Interferon alpha-21
Protein Family
UniProt Gene Name
IFNA21
UniProt Synonym Gene Names
IFN-alpha-21; LeIF F
NCBI Description
This gene is a member of the alpha interferon gene cluster on the short arm of chromosome 9. Interferons are cytokines produced in response to viral infection that mediate the immune response and interfere with viral replication. The encoded protein is a type I interferon and may play a specific role in the antiviral response to rubella virus. [provided by RefSeq, Sep 2011]
Uniprot Description
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Research Articles on IFNA21
Similar Products
Product Notes
The IFNA21 ifna21 (Catalog #AAA9141001) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNA21 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IFNA21 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the IFNA21 ifna21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFNA21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
