Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GPR146Sample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Rabbit GPR146 Polyclonal Antibody | anti-GPR146 antibody

GPR146 Antibody - middle region

Gene Names
Gpr146; PGR8; BC003323; D830046C22Rik
Reactivity
Tested: Mouse; Predicted: Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
GPR146; Polyclonal Antibody; GPR146 Antibody - middle region; anti-GPR146 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested: Mouse; Predicted: Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Applicable Applications for anti-GPR146 antibody
Western Blot (WB)
Protein Size (# AA)
333 amino acids
Peptide Sequence
Synthetic peptide located within the following region: ERALPRTYMASVYNTRHVCGFVWGGAVLTSFSSLLFYICSHVSSRIAECA
Blocking Peptide
For anti-GPR146 (MBS3223817) antibody, please inquire.
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse GPR146.
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GPR146Sample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GPR146Sample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-GPR146 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
probable G-protein coupled receptor 146
NCBI Official Synonym Full Names
G protein-coupled receptor 146
NCBI Official Symbol
Gpr146
NCBI Official Synonym Symbols
PGR8; BC003323; D830046C22Rik
NCBI Protein Information
probable G-protein coupled receptor 146
UniProt Protein Name
Probable G-protein coupled receptor 146
UniProt Gene Name
Gpr146
UniProt Entry Name
GP146_MOUSE

Research Articles on GPR146

Similar Products

Product Notes

The GPR146 gpr146 (Catalog #AAA3223817) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR146 Antibody - middle region reacts with Tested: Mouse; Predicted: Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GPR146 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPR146 gpr146 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPR146, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.