Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GPD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Rabbit GPD1 Polyclonal Antibody | anti-GPD1 antibody

GPD1 antibody - middle region

Gene Names
GPD1; GPD-C; HTGTI; GPDH-C
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPD1; Polyclonal Antibody; GPD1 antibody - middle region; anti-GPD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
Sequence Length
349
Applicable Applications for anti-GPD1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GPD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GPD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-GPD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-GPD1 antibody
This is a rabbit polyclonal antibody against GPD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
glycerol-3-phosphate dehydrogenase
NCBI Official Synonym Full Names
glycerol-3-phosphate dehydrogenase 1
NCBI Official Symbol
GPD1
NCBI Official Synonym Symbols
GPD-C; HTGTI; GPDH-C
NCBI Protein Information
glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic
UniProt Protein Name
Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic
UniProt Gene Name
GPD1
UniProt Synonym Gene Names
GPD-C; GPDH-C
UniProt Entry Name
GPDA_HUMAN

NCBI Description

This gene encodes a member of the NAD-dependent glycerol-3-phosphate dehydrogenase family. The encoded protein plays a critical role in carbohydrate and lipid metabolism by catalyzing the reversible conversion of dihydroxyacetone phosphate (DHAP) and reduced nicotine adenine dinucleotide (NADH) to glycerol-3-phosphate (G3P) and NAD+. The encoded cytosolic protein and mitochondrial glycerol-3-phosphate dehydrogenase also form a glycerol phosphate shuttle that facilitates the transfer of reducing equivalents from the cytosol to mitochondria. Mutations in this gene are a cause of transient infantile hypertriglyceridemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

GPD1: Defects in GPD1 are a cause of hypertriglyceridemia, transient infantile (HTGTI). An autosomal recessive disorder characterized by onset of moderate to severe transient hypertriglyceridemia in infancy that normalizes with age. The hypertriglyceridemia is associated with hepatomegaly, moderately elevated transaminases, persistent fatty liver, and the development of hepatic fibrosis. Belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family.

Protein type: Oxidoreductase; EC 1.1.1.8; Lipid Metabolism - glycerophospholipid

Chromosomal Location of Human Ortholog: 12q13.12

Cellular Component: glycerol-3-phosphate dehydrogenase complex; mitochondrion; cytosol

Molecular Function: glycerol-3-phosphate dehydrogenase (NAD+) activity; protein homodimerization activity; glycerol-3-phosphate dehydrogenase activity; NAD binding

Biological Process: NADH oxidation; phospholipid metabolic process; glycerophospholipid biosynthetic process; positive regulation of glycolysis; phosphatidic acid biosynthetic process; triacylglycerol biosynthetic process; glycerophosphate shuttle; cellular lipid metabolic process; glycerol-3-phosphate catabolic process; gluconeogenesis

Disease: Hypertriglyceridemia, Transient Infantile

Research Articles on GPD1

Similar Products

Product Notes

The GPD1 gpd1 (Catalog #AAA3206257) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPD1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's GPD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPD1 gpd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TFLESCGVAD LITTCYGGRN RKVAEAFART GKSIEQLEKE LLNGQKLQGP. It is sometimes possible for the material contained within the vial of "GPD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.