Western Blot (WB)
(WB Suggested Anti-CYB561 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Rabbit CYB561 Polyclonal Antibody | anti-CYB561 antibody
CYB561 antibody - middle region
Gene Names
CYB561; FRRS2; ORTHYP2; CYB561A1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYB561; Polyclonal Antibody; CYB561 antibody - middle region; anti-CYB561 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ
Sequence Length
251
Applicable Applications for anti-CYB561 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYB561
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CYB561 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-CYB561 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Related Product Information for anti-CYB561 antibody
This is a rabbit polyclonal antibody against CYB561. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CYB561 is a senescene-associated protein in normal human oral keratinocytes. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Target Description: CYB561 is a senescene-associated protein in normal human oral keratinocytes. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Product Categories/Family for anti-CYB561 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
cytochrome b561 isoform 1
NCBI Official Synonym Full Names
cytochrome b561
NCBI Official Symbol
CYB561
NCBI Official Synonym Symbols
FRRS2; ORTHYP2; CYB561A1
NCBI Protein Information
cytochrome b561
UniProt Protein Name
Cytochrome b561
UniProt Gene Name
CYB561
UniProt Entry Name
CY561_HUMAN
Uniprot Description
CYB561: Secretory vesicle-specific electron transport protein.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 17q23.3
Cellular Component: integral to membrane
Molecular Function: metal ion binding; ferric-chelate reductase activity; transmembrane electron transfer carrier
Biological Process: transmembrane transport
Research Articles on CYB561
Similar Products
Product Notes
The CYB561 cyb561 (Catalog #AAA3206081) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYB561 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CYB561 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYB561 cyb561 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVLGLLLACF GGAVLYILTR ADWKRPSQAE EQALSMDFKT LTEGDSPGSQ. It is sometimes possible for the material contained within the vial of "CYB561, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
