GNAQ Polyclonal Antibody | anti-GNAQ antibody

Anti-GNAQ Antibody

Cat. Num. AAA178070

• Gene Names: GNAQ; GAQ; SWS; CMC1; G-ALPHA-q
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: GNAQ; Polyclonal Antibody; Anti-GNAQ Antibody; Guanine nucleotide-binding protein G(q) subunit alpha; CMC1; G alpha Q; G protein alpha Q; G-ALPHA-q; GAQ; GNAQ_HUMAN; guanine nucleotide binding protein (G protein); q polypeptide; Guanine nucleotide binding protein alpha q; guanine nucleotide binding protein G protein q polypeptide; Guanine nucleotide binding protein G q subunit alpha; Guanine nucleotide-binding protein alpha-q; SWS; anti-GNAQ antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 359

• Applicable Applications for anti-GNAQ antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- GNAQ Picoband antibody, MBS178070, Western blottingAll lanes: Anti GNAQ (MBS178070) at 0.5ug/mlLane 1: Rat Ovary Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: Mouse Testis Tissue Lysate at 50ugLane 4: 22RV1 Whole Cell Lysate at 40ugLane 5: SKOV Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD )

Immunohistochemistry (IHC)

(Anti- GNAQ Picoband antibody, MBS178070, IHC(P)IHC(P): Mouse Testis Tissue )

Immunohistochemistry (IHC)

(Anti- GNAQ Picoband antibody, MBS178070, IHC(P)IHC(P): Rat Ovary Tissue )

Immunohistochemistry (IHC)

(Anti- GNAQ Picoband antibody, MBS178070, IHC(P)IHC(P): Human Prostatic Cancer Tissue )

Related Product Information for anti-GNAQ antibody

Description: Rabbit IgG polyclonal antibody for Guanine nucleotide-binding protein G(q) subunit alpha(GNAQ) detection. Tested with WB, IHC-P in Human;Rat;Mouse.

Background: Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

References

1. Dong Q, Shenker A, Way J, Haddad BR, Lin K, Hughes MR, McBride OW, Spiegel AM, Battey J (February 1997). "Molecular cloning of human G alpha q cDNA and chromosomal localization of the G alpha q gene (GNAQ) and a processed pseudogene".Genomics 30 (3): 470-75. 2. Shirley MD, Tang H, Gallione CJ, Baugher JD, Frelin LP, Cohen B, North PE, Marchuk DA, Comi AM, Pevsner J (May 23, 2013). "Sturge-Weber syndrome and port-wine stains caused by somatic mutation in GNAQ.". The New England Journal of Medicine368 (21): 1971-9.

NCBI and Uniprot Product Information

• NCBI GI #: 40254462
• NCBI GeneID: 2776
• NCBI Accession #: NP_002063.2
• NCBI GenBank Nucleotide #: NM_002072.4
• UniProt Accession #: P50148; O15108; Q13462; Q6NT27; Q92471; Q9BZB9
• Molecular Weight: 42,142 Da
• NCBI Official Full Name: guanine nucleotide-binding protein G(q) subunit alpha
• NCBI Official Synonym Full Names: G protein subunit alpha q
• NCBI Official Symbol: GNAQ
• NCBI Official Synonym Symbols: GAQ; SWS; CMC1; G-ALPHA-q
• NCBI Protein Information: guanine nucleotide-binding protein G(q) subunit alpha
• UniProt Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha
• UniProt Gene Name: GNAQ
• UniProt Synonym Gene Names: GAQ
• UniProt Entry Name: GNAQ_HUMAN

NCBI Description

This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010]

Uniprot Description

G-alpha(q): a guanine nucleotide-binding protein of the G12 class of G-alpha proteins. Agonist binding to Gq-coupled receptors may block Akt activation via the release of active G-alpha(q) subunits that inhibit phosphatidylinositol 3-kinase. Heterotrimeric G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site.

Protein type: G protein, heterotrimeric; G protein; G protein, heterotrimeric alpha G(q)

Chromosomal Location of Human Ortholog: 9q21

Cellular Component: cytoplasm; dendrite; lysosomal membrane; nuclear membrane; photoreceptor outer segment; plasma membrane

Molecular Function: G-protein beta/gamma-subunit binding; GTP binding; GTPase activator activity; GTPase activity; metal ion binding; protein binding; signal transducer activity; type 2A serotonin receptor binding

Biological Process: acetylcholine receptor signaling, muscarinic pathway; blood coagulation; dopamine receptor, phospholipase C activating pathway; embryonic digit morphogenesis; entrainment of circadian clock; forebrain neuron development; G-protein signaling, adenylate cyclase activating pathway; glutamate signaling pathway; heart development; maternal behavior; metabolic process; negative regulation of protein kinase activity; neuron remodeling; phospholipase C activation; phototransduction, visible light; pigmentation during development; platelet activation; positive regulation of GTPase activity; post-embryonic development; protein stabilization; regulation of action potential; regulation of melanocyte differentiation; skeletal development

Disease: Capillary Malformations, Congenital; Sturge-weber Syndrome