Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human CES2 Monoclonal Antibody | anti-CES2 antibody

CES2 (Cocaine Esterase, Carboxylesterase 2, CE-2, hCE-2, Methylumbelliferyl-acetate Deacetylase 2, ICE, CES2A1) (HRP)

Gene Names
CES2; iCE; CE-2; PCE-2; CES2A1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CES2; Monoclonal Antibody; CES2 (Cocaine Esterase; Carboxylesterase 2; CE-2; hCE-2; Methylumbelliferyl-acetate Deacetylase 2; ICE; CES2A1) (HRP); anti-CES2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F12
Specificity
Recognizes human CES2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CES2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa514-622 from CES2 (NP_003860) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(CES2 monoclonal antibody Western Blot analysis of CES2 expression in HepG2.)

Western Blot (WB) (CES2 monoclonal antibody Western Blot analysis of CES2 expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CES2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CES2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of CES2 transfected lysate using CES2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CES2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CES2 transfected lysate using CES2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CES2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CES2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CES2 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-CES2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,959 Da
NCBI Official Full Name
cocaine esterase isoform 1
NCBI Official Synonym Full Names
carboxylesterase 2
NCBI Official Symbol
CES2
NCBI Official Synonym Symbols
iCE; CE-2; PCE-2; CES2A1
NCBI Protein Information
cocaine esterase; carboxylesterase 2 (intestine, liver); hCE-2; intestinal carboxylesterase; liver carboxylesterase-2; methylumbelliferyl-acetate deacetylase 2
UniProt Protein Name
Cocaine esterase
Protein Family
UniProt Gene Name
CES2
UniProt Synonym Gene Names
ICE; CE-2; hCE-2
UniProt Entry Name
EST2_HUMAN

Uniprot Description

CES2: Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows high catalytic efficiency for hydrolysis of cocaine, 4-methylumbelliferyl acetate, heroin and 6-monoacetylmorphine. Belongs to the type-B carboxylesterase/lipase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.1.56; EC 3.1.1.84; Xenobiotic Metabolism - drug metabolism - other enzymes; Endoplasmic reticulum; EC 3.1.1.1; Hydrolase

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: extracellular space; endoplasmic reticulum; endoplasmic reticulum lumen

Molecular Function: methylumbelliferyl-acetate deacetylase activity

Biological Process: catabolic process

Similar Products

Product Notes

The CES2 ces2 (Catalog #AAA6151762) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CES2 (Cocaine Esterase, Carboxylesterase 2, CE-2, hCE-2, Methylumbelliferyl-acetate Deacetylase 2, ICE, CES2A1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CES2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CES2 ces2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CES2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.