Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GNAL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateGNAL is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit GNAL Polyclonal Antibody | anti-GNAL antibody

GNAL antibody - C-terminal region

Gene Names
GNAL; DYT25
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNAL; Polyclonal Antibody; GNAL antibody - C-terminal region; anti-GNAL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR
Sequence Length
458
Applicable Applications for anti-GNAL antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GNAL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GNAL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateGNAL is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-GNAL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateGNAL is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-GNAL antibody
This is a rabbit polyclonal antibody against GNAL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(olf) subunit alpha isoform 1
NCBI Official Synonym Full Names
G protein subunit alpha L
NCBI Official Symbol
GNAL
NCBI Official Synonym Symbols
DYT25
NCBI Protein Information
guanine nucleotide-binding protein G(olf) subunit alpha
UniProt Protein Name
Guanine nucleotide-binding protein G(olf) subunit alpha
UniProt Gene Name
GNAL
UniProt Entry Name
GNAL_HUMAN

NCBI Description

This gene encodes a stimulatory G protein alpha subunit which mediates odorant signaling in the olfactory epithelium. This protein couples dopamine type 1 receptors and adenosine A2A receptors and is widely expressed in the central nervous system. Mutations in this gene have been associated with dystonia 25 and this gene is located in a susceptibility region for bipolar disorder and schizophrenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

G-alpha(olf): Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. May be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters. Belongs to the G-alpha family. G(s) subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, heterotrimeric; G protein, heterotrimeric alpha G(s); Membrane protein, peripheral

Chromosomal Location of Human Ortholog: 18p11.22-p11.21

Cellular Component: plasma membrane; heterotrimeric G-protein complex

Molecular Function: GTPase activity; signal transducer activity; GTP binding; G-protein-coupled receptor binding; metal ion binding; G-protein beta/gamma-subunit binding

Biological Process: synaptic transmission; metabolic process; adenylate cyclase activation; sensory perception of smell; response to amphetamine; G-protein signaling, adenylate cyclase inhibiting pathway; signal transduction; G-protein signaling, adenylate cyclase activating pathway; dopamine receptor, adenylate cyclase activating pathway; response to caffeine

Disease: Dystonia 25

Research Articles on GNAL

Similar Products

Product Notes

The GNAL gnal (Catalog #AAA3211777) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAL antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNAL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNAL gnal for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEKVLAGKSK IEDYFPEYAN YTVPEDATPD AGEDPKVTRA KFFIRDLFLR. It is sometimes possible for the material contained within the vial of "GNAL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.