Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: GNA13Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Rabbit GNA13 Polyclonal Antibody | anti-GNA13 antibody

GNA13 Antibody - N-terminal region

Gene Names
GNA13; G13
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNA13; Polyclonal Antibody; GNA13 Antibody - N-terminal region; anti-GNA13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLK
Sequence Length
377
Applicable Applications for anti-GNA13 antibody
Western Blot (WB)
Homology
Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNA13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: GNA13Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: GNA13Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-GNA13 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Western Blot (WB) (WB Suggested Anti-GNA13 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Related Product Information for anti-GNA13 antibody
This is a rabbit polyclonal antibody against GNA13. It was validated on Western Blot

Target Description: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Product Categories/Family for anti-GNA13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
guanine nucleotide-binding protein subunit alpha-13 isoform 1
NCBI Official Synonym Full Names
G protein subunit alpha 13
NCBI Official Symbol
GNA13
NCBI Official Synonym Symbols
G13
NCBI Protein Information
guanine nucleotide-binding protein subunit alpha-13
UniProt Protein Name
Guanine nucleotide-binding protein subunit alpha-13
UniProt Gene Name
GNA13
UniProt Synonym Gene Names
G alpha-13; G-protein subunit alpha-13
UniProt Entry Name
GNA13_HUMAN

Uniprot Description

G-alpha 13: a guanine nucleotide-binding protein of the G12 class of G-alpha proteins. Activates Rho. Protein kinase A blocks Rho activation by phosphorylation of G-alpha(13). Heterotrimeric G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site. Regulates cytoplasmic as well as nuclear signaling events such as activation of the Jun N-terminal kinase signaling module, Na+/H+ exchangers, focal adhesion assemblies, and transcriptional activation of specific primary response genes.

Protein type: G protein, heterotrimeric alpha G(12); G protein; G protein, heterotrimeric

Chromosomal Location of Human Ortholog: 17q24.3

Cellular Component: focal adhesion; membrane; brush border membrane; plasma membrane; melanosome; heterotrimeric G-protein complex; nucleus

Molecular Function: GTPase activity; signal transducer activity; protein binding; GTP binding; metal ion binding; G-protein beta/gamma-subunit binding; type 1 angiotensin receptor binding; D5 dopamine receptor binding

Biological Process: phospholipase D activation; platelet activation; metabolic process; in utero embryonic development; signal transduction; G-protein signaling, adenylate cyclase activating pathway; regulation of cell migration; Rho protein signal transduction; patterning of blood vessels; regulation of cell shape; elevation of cytosolic calcium ion concentration; blood coagulation; cell differentiation; cell motility

Research Articles on GNA13

Similar Products

Product Notes

The GNA13 gna13 (Catalog #AAA3217080) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNA13 Antibody - N-terminal region reacts with Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNA13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNA13 gna13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GCLLTSGEAE QQRKSKEIDK CLSREKTYVK RLVKILLLGA GESGKSTFLK. It is sometimes possible for the material contained within the vial of "GNA13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.