Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: human thryoidSample Type: Nthy-ori cell lysate (50ug)Primary Dilution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:2000Image Submitted By: Anonymous)

Rabbit GNAI2 Polyclonal Antibody | anti-GNAI2 antibody

GNAI2 antibody - C-terminal region

Gene Names
GNAI2; GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNAI2; Polyclonal Antibody; GNAI2 antibody - C-terminal region; anti-GNAI2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA
Sequence Length
355
Applicable Applications for anti-GNAI2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GNAI2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: human thryoidSample Type: Nthy-ori cell lysate (50ug)Primary Dilution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:2000Image Submitted By: Anonymous)

Western Blot (WB) (Sample Type: human thryoidSample Type: Nthy-ori cell lysate (50ug)Primary Dilution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:2000Image Submitted By: Anonymous)

Western Blot (WB)

(Host: MouseTarget Name: GNAI2Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: GNAI2Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-GNAI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-GNAI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)
Related Product Information for anti-GNAI2 antibody
This is a rabbit polyclonal antibody against GNAI2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(i) subunit alpha-2 isoform 1
NCBI Official Synonym Full Names
G protein subunit alpha i2
NCBI Official Symbol
GNAI2
NCBI Official Synonym Symbols
GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
NCBI Protein Information
guanine nucleotide-binding protein G(i) subunit alpha-2
UniProt Protein Name
Guanine nucleotide-binding protein G(i) subunit alpha-2
UniProt Gene Name
GNAI2
UniProt Synonym Gene Names
GNAI2B
UniProt Entry Name
GNAI2_HUMAN

NCBI Description

The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

G-alpha i2: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli. May play a role in cell division. Belongs to the G-alpha family. G(i/o/t/z) subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein; G protein, heterotrimeric; G protein, heterotrimeric alpha G((i/o/t/z))

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: nucleoplasm; centrosome; membrane; cytoplasm; plasma membrane; heterotrimeric G-protein complex; midbody; cytosol; vesicle; lipid raft

Molecular Function: GTPase activity; signal transducer activity; protein binding; G-protein-coupled receptor binding; GTP binding; metal ion binding; G-protein beta/gamma-subunit binding

Biological Process: platelet activation; acetylcholine receptor signaling, muscarinic pathway; activation of MAPKK activity; metabolic process; negative regulation of adenylate cyclase activity; regulation of calcium ion transport; cell cycle; signal transduction; negative regulation of synaptic transmission; G-protein coupled receptor protein signaling pathway; synaptic transmission; cell proliferation; cell division; positive regulation of cell proliferation; G-protein signaling, adenylate cyclase inhibiting pathway; blood coagulation; adenosine receptor signaling pathway; gamma-aminobutyric acid signaling pathway; response to nutrient

Disease: Ventricular Tachycardia, Familial

Research Articles on GNAI2

Similar Products

Product Notes

The GNAI2 gnai2 (Catalog #AAA3211776) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAI2 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNAI2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNAI2 gnai2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EYTGANKYDE AASYIQSKFE DLNKRKDTKE IYTHFTCATD TKNVQFVFDA. It is sometimes possible for the material contained within the vial of "GNAI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.