Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GLRX3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateGLRX3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit GLRX3 Polyclonal Antibody | anti-GLRX3 antibody

GLRX3 antibody - N-terminal region

Gene Names
GLRX3; GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3
Reactivity
Cow, Dog, Human, Mouse, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GLRX3; Polyclonal Antibody; GLRX3 antibody - N-terminal region; anti-GLRX3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
Sequence Length
335
Applicable Applications for anti-GLRX3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Human: 100%; Mouse: 85%; Pig: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GLRX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GLRX3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateGLRX3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB) (WB Suggested Anti-GLRX3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateGLRX3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Related Product Information for anti-GLRX3 antibody
This is a rabbit polyclonal antibody against GLRX3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GLRX3 may play a role in regulating the function of the thioredoxin system.
Product Categories/Family for anti-GLRX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
glutaredoxin-3 isoform 1
NCBI Official Synonym Full Names
glutaredoxin 3
NCBI Official Symbol
GLRX3
NCBI Official Synonym Symbols
GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3
NCBI Protein Information
glutaredoxin-3
UniProt Protein Name
Glutaredoxin-3
Protein Family
UniProt Gene Name
GLRX3
UniProt Synonym Gene Names
PICOT; TXNL2; PICOT; PKCq-interacting protein
UniProt Entry Name
GLRX3_HUMAN

NCBI Description

This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The encoded protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

GLRX3: Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator. May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.

Protein type: Oxidoreductase

Chromosomal Location of Human Ortholog: 10q26

Cellular Component: cell cortex; Z disc

Molecular Function: protein binding; electron carrier activity; protein kinase C binding; metal ion binding; iron-sulfur cluster binding; protein disulfide oxidoreductase activity

Biological Process: cell redox homeostasis; regulation of the force of heart contraction

Research Articles on GLRX3

Similar Products

Product Notes

The GLRX3 glrx3 (Catalog #AAA3213988) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLRX3 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's GLRX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GLRX3 glrx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEELLRRELG CSSVRATGHS GGGCISQGRS YDTDQGRVFV KVNPKAEARR. It is sometimes possible for the material contained within the vial of "GLRX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.