Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-GLRA2 Polyclonal Antibody)

Rabbit GLRA2 Polyclonal Antibody | anti-GLRA2 antibody

GLRA2 Polyclonal Antibody

Gene Names
GLRA2; GLR
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
GLRA2; Polyclonal Antibody; GLRA2 Polyclonal Antibody; GLR; glycine receptor alpha 2; anti-GLRA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.48 mg/ml (varies by lot)
Sequence Length
452
Applicable Applications for anti-GLRA2 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 350-420 of human GLRA2 (NP_002054.1).
Immunogen Sequence
RLRRRQKRQNKEEDVTRESRFNFSGYGMGHCLQVKDGTAVKATPANPLPQPPKDGDAIKKKFVDRAKRIDT
Positive Samples
Mouse Spinal Cord, Rat Brain
Cellular Location
Cell Junction, Cell Membrane, Multi-Pass Membrane Protein, Postsynaptic Cell Membrane, Synapse
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-GLRA2 Polyclonal Antibody)

Western Blot (WB) (Western blot-GLRA2 Polyclonal Antibody)
Related Product Information for anti-GLRA2 antibody
The glycine receptor consists of two subunits, alpha and beta, and acts as a pentamer. The protein encoded by this gene is an alpha subunit and can bind strychnine. Several transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 42kDa; 51kDa; 52kDa
Observed: 52kDa
NCBI Official Full Name
Glycine receptor subunit alpha-2
NCBI Official Synonym Full Names
glycine receptor alpha 2
NCBI Official Symbol
GLRA2
NCBI Official Synonym Symbols
GLR
NCBI Protein Information
glycine receptor subunit alpha-2
UniProt Protein Name
Glycine receptor subunit alpha-2
Protein Family
UniProt Gene Name
GLRA2
UniProt Entry Name
GLRA2_HUMAN

NCBI Description

The glycine receptor consists of two subunits, alpha and beta, and acts as a pentamer. The protein encoded by this gene is an alpha subunit and can bind strychnine. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2010]

Uniprot Description

GLRA2: The glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing). Belongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA2 sub- subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, ion channel

Chromosomal Location of Human Ortholog: Xp22.2

Cellular Component: postsynaptic membrane; integral to plasma membrane; plasma membrane; cell junction

Molecular Function: transmitter-gated ion channel activity; extracellular-glycine-gated chloride channel activity; glycine binding

Biological Process: neuropeptide signaling pathway; ion transport; transmembrane transport

Research Articles on GLRA2

Similar Products

Product Notes

The GLRA2 glra2 (Catalog #AAA9140416) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLRA2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GLRA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:100. Researchers should empirically determine the suitability of the GLRA2 glra2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLRA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.