Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-TENM1 Polyclonal Antibody)

Rabbit anti-Human TENM1 Polyclonal Antibody | anti-TENM1 antibody

TENM1 Polyclonal Antibody

Gene Names
TENM1; TNM; ODZ1; ODZ3; TNM1; ten-1; TEN-M1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TENM1; Polyclonal Antibody; TENM1 Polyclonal Antibody; ODZ1; ODZ3; TEN-M1; TNM; TNM1; teneurin-1; anti-TENM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.43 mg/ml (varies by lot)
Sequence Length
2732
Applicable Applications for anti-TENM1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 350-540 of human TENM1 (NP_001156750.1).
Immunogen Sequence
QPVEGELYANGVSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQHSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
Positive Samples
U-87MG, U-251MG, HeLa
Cellular Location
Cell Membrane, Cytoplasm, Nucleus, Nucleus Matrix, Nucleus Speckle, Single-Pass Membrane Protein, Cytoskeleton
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-TENM1 Polyclonal Antibody)

Western Blot (WB) (Western blot-TENM1 Polyclonal Antibody)
Related Product Information for anti-TENM1 antibody
The protein encoded by this gene belongs to the tenascin family and teneurin subfamily. It is expressed in the neurons and may function as a cellular signal transducer. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 305kDa
Observed: 280kDa
NCBI Official Full Name
teneurin-1 isoform 1
NCBI Official Synonym Full Names
teneurin transmembrane protein 1
NCBI Official Symbol
TENM1
NCBI Official Synonym Symbols
TNM; ODZ1; ODZ3; TNM1; ten-1; TEN-M1
NCBI Protein Information
teneurin-1
UniProt Protein Name
Teneurin-1
UniProt Gene Name
TENM1
UniProt Synonym Gene Names
ODZ1; TNM1; Ten-1; Ten-m1; IDten-1; Ten-1 ICD; TCPA-1; Ten-1 ECD
UniProt Entry Name
TEN1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the tenascin family and teneurin subfamily. It is expressed in the neurons and may function as a cellular signal transducer. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

ODZ1: May function as a cellular signal transducer. Belongs to the tenascin family. Teneurin subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq25

Cellular Component: Golgi apparatus; cytoskeleton; nuclear matrix; integral to plasma membrane; perinuclear region of cytoplasm; endoplasmic reticulum; cytoplasm; extracellular region; plasma membrane; nuclear speck; nucleus

Molecular Function: heparin binding; protein homodimerization activity; protein heterodimerization activity

Biological Process: positive regulation of filopodium formation; nervous system development; negative regulation of cell proliferation; positive regulation of MAP kinase activity; transcription, DNA-dependent; positive regulation of actin filament polymerization; regulation of transcription from RNA polymerase III promoter; neuropeptide signaling pathway; immune response; positive regulation of peptidyl-serine phosphorylation

Research Articles on TENM1

Similar Products

Product Notes

The TENM1 tenm1 (Catalog #AAA9140495) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TENM1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TENM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TENM1 tenm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TENM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.