Western Blot (WB)
(Host: RabbitTarget Name: GIPC2Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit GIPC2 Polyclonal Antibody | anti-GIPC2 antibody
GIPC2 Antibody - C-terminal region
Gene Names
GIPC2; SEMCAP2; SEMCAP-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GIPC2; Polyclonal Antibody; GIPC2 Antibody - C-terminal region; anti-GIPC2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAKAIEKIDDVLELYMGIRDIDLATTMFEAGKDKVNPDEFAVALDETLGD
Sequence Length
315
Applicable Applications for anti-GIPC2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GIPC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GIPC2Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GIPC2Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GIPC2 antibody
This is a rabbit polyclonal antibody against GIPC2. It was validated on Western Blot
Target Description: GIPC1/GIPC, GIPC2, and GIPC3 are a family of central PDZ-domain proteins. GIPC2 might play important roles in human gastric cancer through modulation of growth factor signaling or cell adhesion. GIPC1, GIPC2 and GIPC3 might play key roles in carcinogenesis and embryogenesis through modulation of growth factor signaling and cell adhesion.
Target Description: GIPC1/GIPC, GIPC2, and GIPC3 are a family of central PDZ-domain proteins. GIPC2 might play important roles in human gastric cancer through modulation of growth factor signaling or cell adhesion. GIPC1, GIPC2 and GIPC3 might play key roles in carcinogenesis and embryogenesis through modulation of growth factor signaling and cell adhesion.
Product Categories/Family for anti-GIPC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
PDZ domain-containing protein GIPC2 isoform 1
NCBI Official Synonym Full Names
GIPC PDZ domain containing family member 2
NCBI Official Symbol
GIPC2
NCBI Official Synonym Symbols
SEMCAP2; SEMCAP-2
NCBI Protein Information
PDZ domain-containing protein GIPC2
UniProt Protein Name
PDZ domain-containing protein GIPC2
Protein Family
UniProt Gene Name
GIPC2
UniProt Entry Name
GIPC2_HUMAN
Uniprot Description
GIPC2: Belongs to the GIPC family.
Chromosomal Location of Human Ortholog: 1p31.1
Cellular Component: cytoplasm
Research Articles on GIPC2
Similar Products
Product Notes
The GIPC2 gipc2 (Catalog #AAA3205748) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GIPC2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GIPC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GIPC2 gipc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAKAIEKIDD VLELYMGIRD IDLATTMFEA GKDKVNPDEF AVALDETLGD. It is sometimes possible for the material contained within the vial of "GIPC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
