Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GIPC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit GIPC1 Polyclonal Antibody | anti-GIPC1 antibody

GIPC1 antibody - N-terminal region

Gene Names
GIPC1; NIP; GIPC; IIP-1; TIP-2; SEMCAP; C19orf3; Hs.6454; GLUT1CBP; RGS19IP1; SYNECTIN; SYNECTIIN
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GIPC1; Polyclonal Antibody; GIPC1 antibody - N-terminal region; anti-GIPC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA
Sequence Length
333
Applicable Applications for anti-GIPC1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GIPC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GIPC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-GIPC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-GIPC1 antibody
This is a rabbit polyclonal antibody against GIPC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GIPC1 belongs to the GIPC family. It may be involved in G protein-linked signaling.
Product Categories/Family for anti-GIPC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
PDZ domain-containing protein GIPC1 isoform 1
NCBI Official Synonym Full Names
GIPC PDZ domain containing family member 1
NCBI Official Symbol
GIPC1
NCBI Official Synonym Symbols
NIP; GIPC; IIP-1; TIP-2; SEMCAP; C19orf3; Hs.6454; GLUT1CBP; RGS19IP1; SYNECTIN; SYNECTIIN
NCBI Protein Information
PDZ domain-containing protein GIPC1
UniProt Protein Name
PDZ domain-containing protein GIPC1
UniProt Gene Name
GIPC1
UniProt Synonym Gene Names
C19orf3; GIPC; RGS19IP1; TIP-2
UniProt Entry Name
GIPC1_HUMAN

NCBI Description

GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM, Apr 2009]

Uniprot Description

GIPC1: May be involved in G protein-linked signaling. Belongs to the GIPC family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Vesicle; GAPs, misc.; GAPs

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: synaptic vesicle; membrane; endocytic vesicle; cytoplasm; cytoplasmic membrane-bound vesicle; dendritic spine; vesicle membrane; dendritic shaft; cell cortex; cytosol; brush border

Molecular Function: protein binding; protein homodimerization activity; myosin binding; actin binding; receptor binding; PDZ domain binding

Biological Process: positive regulation of cytokinesis; synaptic transmission; G-protein coupled receptor protein signaling pathway; glutamate secretion; positive regulation of transforming growth factor beta receptor signaling pathway; regulation of protein stability; endothelial cell migration; regulation of synaptic plasticity; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; protein targeting

Research Articles on GIPC1

Similar Products

Product Notes

The GIPC1 gipc1 (Catalog #AAA3205350) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GIPC1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GIPC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GIPC1 gipc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGGPQMGLPP PPPALRPRLV FHTQLAHGSP TGRIEGFTNV KELYGKIAEA. It is sometimes possible for the material contained within the vial of "GIPC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.