Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GINS1 expression in transfected 293T cell line by GINS1 MaxPab polyclonal antibody.Lane 1: GINS1 transfected lysate(21.67 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human GINS1 Polyclonal Antibody | anti-GINS1 antibody

GINS1 (GINS Complex Subunit 1 (Psf1 Homolog), KIAA0186, PSF1) (HRP)

Gene Names
GINS1; PSF1; RP4-691N24.2
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
GINS1; Polyclonal Antibody; GINS1 (GINS Complex Subunit 1 (Psf1 Homolog); KIAA0186; PSF1) (HRP); GINS Complex Subunit 1 (Psf1 Homolog); PSF1; anti-GINS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GINS1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-GINS1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GINS1 (AAH12542.1, 1aa-196aa) full-length human protein.
Immunogen Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.

Western Blot (WB)

(Western Blot analysis of GINS1 expression in transfected 293T cell line by GINS1 MaxPab polyclonal antibody.Lane 1: GINS1 transfected lysate(21.67 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GINS1 expression in transfected 293T cell line by GINS1 MaxPab polyclonal antibody.Lane 1: GINS1 transfected lysate(21.67 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(GINS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GINS1 expression in Jurkat.)

Western Blot (WB) (GINS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GINS1 expression in Jurkat.)
Product Categories/Family for anti-GINS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
22,988 Da
NCBI Official Full Name
GINS1 protein
NCBI Official Synonym Full Names
GINS complex subunit 1 (Psf1 homolog)
NCBI Official Symbol
GINS1
NCBI Official Synonym Symbols
PSF1; RP4-691N24.2
NCBI Protein Information
DNA replication complex GINS protein PSF1; partner of sld five-1
UniProt Protein Name
DNA replication complex GINS protein PSF1
UniProt Gene Name
GINS1
UniProt Synonym Gene Names
KIAA0186; PSF1
UniProt Entry Name
PSF1_HUMAN

NCBI Description

The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1, Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]).[supplied by OMIM, Mar 2008]

Uniprot Description

GINS1: The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single- stranded DNA. GINS1 is essential for function. Belongs to the GINS1/PSF1 family.

Protein type: DNA replication; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20p11.21

Cellular Component: nucleoplasm; cytoplasm; nucleus

Biological Process: DNA strand elongation during DNA replication; mitotic cell cycle; inner cell mass cell proliferation

Research Articles on GINS1

Similar Products

Product Notes

The GINS1 gins1 (Catalog #AAA6450974) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GINS1 (GINS Complex Subunit 1 (Psf1 Homolog), KIAA0186, PSF1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GINS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GINS1 gins1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GINS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.