Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GHRHR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateGHRHR is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells)

Rabbit GHRHR Polyclonal Antibody | anti-GHRHR antibody

GHRHR antibody - middle region

Gene Names
GHRHR; GRFR; GHRFR; IGHD4; IGHD1B
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GHRHR; Polyclonal Antibody; GHRHR antibody - middle region; anti-GHRHR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR
Sequence Length
337
Applicable Applications for anti-GHRHR antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 77%; Rabbit: 93%; Rat: 93%; Sheep: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GHRHR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GHRHR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateGHRHR is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells)

Western Blot (WB) (WB Suggested Anti-GHRHR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateGHRHR is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells)
Related Product Information for anti-GHRHR antibody
This is a rabbit polyclonal antibody against GHRHR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GHRHR is a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in its gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dw

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Synonym Full Names
growth hormone releasing hormone receptor
NCBI Official Symbol
GHRHR
NCBI Official Synonym Symbols
GRFR; GHRFR; IGHD4; IGHD1B
NCBI Protein Information
growth hormone-releasing hormone receptor
UniProt Protein Name
Growth hormone-releasing hormone receptor
UniProt Gene Name
GHRHR
UniProt Synonym Gene Names
GHRH receptor; GRF receptor; GRFR
UniProt Entry Name
GHRHR_HUMAN

NCBI Description

This gene encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature. [provided by RefSeq, Jun 2010]

Uniprot Description

GHRHR: Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion. Defects in GHRHR are a cause of growth hormone deficiency isolated type 1B (IGHD1B); also known as dwarfism of Sindh. IGHD1B is an autosomal recessive deficiency of GH which causes short stature. IGHD1B patients have low but detectable levels of GH. Belongs to the G-protein coupled receptor 2 family.

Protein type: GPCR, family 2; Membrane protein, integral; Cell development/differentiation; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7p14

Cellular Component: nuclear outer membrane; cell surface; nuclear matrix; cytoplasm; integral to membrane; plasma membrane; nuclear inner membrane; secretory granule

Molecular Function: G-protein coupled receptor activity; protein binding; peptide hormone binding; growth factor binding; growth hormone-releasing hormone receptor activity

Biological Process: lactation; positive regulation of insulin-like growth factor receptor signaling pathway; response to glucocorticoid stimulus; regulation of protein metabolic process; cell maturation; adenylate cyclase activation; positive regulation of multicellular organism growth; determination of adult life span; reproductive process in a multicellular organism; G-protein signaling, adenylate cyclase activating pathway; response to insulin stimulus; positive regulation of growth hormone secretion; water homeostasis; growth hormone secretion; cAMP-mediated signaling; cellular response to insulin stimulus; response to estrogen stimulus; positive regulation of cell proliferation; positive regulation of cAMP biosynthetic process; somatotropin secreting cell development; hormone metabolic process; regulation of steroid hormone receptor signaling pathway

Disease: Isolated Growth Hormone Deficiency, Type Ib

Research Articles on GHRHR

Similar Products

Product Notes

The GHRHR ghrhr (Catalog #AAA3206054) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GHRHR antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's GHRHR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GHRHR ghrhr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PYPVACPVPL ELLAEEESYF STVKIIYTVG HSISIVALFV AITILVALRR. It is sometimes possible for the material contained within the vial of "GHRHR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.