Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: GDI1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Rabbit GDI1 Polyclonal Antibody | anti-GDI1 antibody

GDI1 antibody - C-terminal region

Gene Names
GDI1; 1A; GDIL; MRX41; MRX48; OPHN2; XAP-4; RABGD1A; RABGDIA
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Sheep, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
GDI1; Polyclonal Antibody; GDI1 antibody - C-terminal region; anti-GDI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ
Sequence Length
447
Applicable Applications for anti-GDI1 antibody
Western Blot (WB)
Homology
Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Sheep: 92%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GDI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: GDI1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: GDI1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Human, Mouse)

Western Blot (WB) (Human, Mouse)

Western Blot (WB)

(WB Suggested Anti-GDI1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-GDI1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-GDI1 antibody
This is a rabbit polyclonal antibody against GDI1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI1 is expressed primarily in neural and sensory tissues. Mutations in GDI1 have been linked to X-linked nonspecific mental retardation.
Product Categories/Family for anti-GDI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
rab GDP dissociation inhibitor alpha
NCBI Official Synonym Full Names
GDP dissociation inhibitor 1
NCBI Official Symbol
GDI1
NCBI Official Synonym Symbols
1A; GDIL; MRX41; MRX48; OPHN2; XAP-4; RABGD1A; RABGDIA
NCBI Protein Information
rab GDP dissociation inhibitor alpha
UniProt Protein Name
Rab GDP dissociation inhibitor alpha
UniProt Gene Name
GDI1
UniProt Synonym Gene Names
GDIL; OPHN2; RABGDIA; XAP4; Rab GDI alpha; GDI-1
UniProt Entry Name
GDIA_HUMAN

NCBI Description

GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI1 is expressed primarily in neural and sensory tissues. Mutations in GDI1 have been linked to X-linked nonspecific cognitive disability. [provided by RefSeq, Jul 2008]

Uniprot Description

GDI1: a GDP dissociation inhibitor protein expressed primarily in neural and sensory tissues. GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the Rab family, small GTP-binding proteins of the Ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from Rab proteins and release GDP from membrane-bound Rabs. Mutations have been linked to X-linked nonspecific mental retardation.

Protein type: G protein regulator, misc.; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: Golgi apparatus; neuron projection; protein complex; cytoplasm; midbody; cytosol

Molecular Function: protein binding; GDP-dissociation inhibitor activity; Rab GDP-dissociation inhibitor activity; Rab GTPase binding; GTPase activator activity

Biological Process: protein transport; regulation of small GTPase mediated signal transduction; small GTPase mediated signal transduction; negative regulation of axonogenesis; Rab protein signal transduction; response to calcium ion; signal transduction; positive regulation of GTPase activity

Disease: Mental Retardation, X-linked 41

Research Articles on GDI1

Similar Products

Product Notes

The GDI1 gdi1 (Catalog #AAA3224518) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GDI1 antibody - C-terminal region reacts with Guinea Pig, Horse, Human, Mouse, Rabbit, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GDI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GDI1 gdi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFCSCSYDAT THFETTCNDI KDIYKRMAGT AFDFENMKRK QNDVFGEAEQ. It is sometimes possible for the material contained within the vial of "GDI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.