Western Blot (WB)
(Western Blot analysis of GCET2 expression in transfected 293T cell line by GCET2 polyclonal antibody. Lane 1: GCET2 transfected lysate (19.58kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human GCET2 Polyclonal Antibody | anti-GCSAM antibody
GCET2 (Germinal Center B-cell-expressed Transcript 2 Protein, Germinal Center-associated Lymphoma Protein, hGAL, GAL, MGC40441)
Gene Names
GCSAM; HGAL; GCAT2; GCET2
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
GCET2; Polyclonal Antibody; GCET2 (Germinal Center B-cell-expressed Transcript 2 Protein; Germinal Center-associated Lymphoma Protein; hGAL; GAL; MGC40441); Anti -GCET2 (Germinal Center B-cell-expressed Transcript 2 Protein; anti-GCSAM antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GCET2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL
Applicable Applications for anti-GCSAM antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GCET2, aa1-178 (NP_689998.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of GCET2 expression in transfected 293T cell line by GCET2 polyclonal antibody. Lane 1: GCET2 transfected lysate (19.58kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of GCET2 expression in transfected 293T cell line by GCET2 polyclonal antibody. Lane 1: GCET2 transfected lysate (19.58kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GCSAM antibody
GCET2, commonly known as germinal center B cell expressed transcript 2 protein, is a 178aa protein expressed in diffuse large B cell lymphoma (DLBCL) and several germinal center (GC) like lymphoma cell lines (at protein level). It is highly expressed in normal GC lymphocytes and GC derived malignancies, as well as being present in the thymus and spleen. In B cells expression of the HGAL gene is specifically induced by interleukin 4.
Product Categories/Family for anti-GCSAM antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,005 Da
NCBI Official Full Name
germinal center-associated signaling and motility protein isoform 4
NCBI Official Synonym Full Names
germinal center-associated, signaling and motility
NCBI Official Symbol
GCSAM
NCBI Official Synonym Symbols
HGAL; GCAT2; GCET2
NCBI Protein Information
germinal center-associated signaling and motility protein; germinal center expressed transcript 2; human germinal center-associated lymphoma; germinal center-associated lymphoma protein; germinal center B-cell-expressed transcript 2 protein
UniProt Protein Name
Germinal center-associated signaling and motility protein
Protein Family
UniProt Gene Name
GCSAM
UniProt Synonym Gene Names
GAL; GCET2; hGAL
UniProt Entry Name
GCSAM_HUMAN
NCBI Description
This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Uniprot Description
GCET2: a protein expressed in normal germinal center B cells, immature B and T cells. Induced by IL4. Its expression strongly predicts survival in diffuse large B-cell lymphoma.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 3q13.2
Cellular Component: cytoplasm; plasma membrane
Molecular Function: protein binding; actin binding; protein kinase binding; myosin II binding
Biological Process: regulation of B cell receptor signaling pathway
Research Articles on GCSAM
Similar Products
Product Notes
The GCSAM gcsam (Catalog #AAA6007624) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GCET2 (Germinal Center B-cell-expressed Transcript 2 Protein, Germinal Center-associated Lymphoma Protein, hGAL, GAL, MGC40441) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCET2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GCSAM gcsam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGNSLLRENR RQQNTQEMPW NVRMQSPKQR TSRCWDHHIA EGCFCLPWKK ILIFEKRQDS QNENERMSST PIQDNVDQTY SEELCYTLIN HRVLCTRPSG NSAEEYYENV PCKAERPRES LGGTETEYSL LHMPSTDPRH ARSPEDEYEL LMPHRISSHF LQQPRPLMAP SETQFSHL. It is sometimes possible for the material contained within the vial of "GCET2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
