Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: 25 ug empty vector transfected H460 cell lysateLane 2: 25 ug hGATA5 transfected H460 cell lysatePrimary Antibody Dilution:1:1200Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3500Gene Name:GATA5Submitted by:Anonymous)

Rabbit GATA5 Polyclonal Antibody | anti-GATA5 antibody

GATA5 antibody - middle region

Gene Names
GATA5; CHTD5; GATAS; bB379O24.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GATA5; Polyclonal Antibody; GATA5 antibody - middle region; anti-GATA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFP
Sequence Length
397
Applicable Applications for anti-GATA5 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 77%; Rat: 77%; Sheep: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GATA5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: 25 ug empty vector transfected H460 cell lysateLane 2: 25 ug hGATA5 transfected H460 cell lysatePrimary Antibody Dilution:1:1200Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3500Gene Name:GATA5Submitted by:Anonymous)

Western Blot (WB) (Lanes:Lane 1: 25 ug empty vector transfected H460 cell lysateLane 2: 25 ug hGATA5 transfected H460 cell lysatePrimary Antibody Dilution:1:1200Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3500Gene Name:GATA5Submitted by:Anonymous)

Western Blot (WB)

(WB Suggested Anti-GATA5 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-GATA5 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Related Product Information for anti-GATA5 antibody
This is a rabbit polyclonal antibody against GATA5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
transcription factor GATA-5
NCBI Official Synonym Full Names
GATA binding protein 5
NCBI Official Symbol
GATA5
NCBI Official Synonym Symbols
CHTD5; GATAS; bB379O24.1
NCBI Protein Information
transcription factor GATA-5
UniProt Protein Name
Transcription factor GATA-5
Protein Family
UniProt Gene Name
GATA5
UniProt Entry Name
GATA5_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity. [provided by RefSeq, Jul 2008]

Uniprot Description

GATA5: Binds to the functionally important CEF-1 nuclear protein binding site in the cardiac-specific slow/cardiac troponin C transcriptional enhancer. May play an important role in the transcriptional program(s) that underlies smooth muscle cell diversity. Rare variants in GATA5 may be a cause of susceptibility to atrial fibrillation, a common sustained cardiac rhythm disturbance. Atrial fibrillation is characterized by disorganized atrial electrical activity and ineffective atrial contraction promoting blood stasis in the atria and reduces ventricular filling. It can result in palpitations, syncope, thromboembolic stroke, and congestive heart failure.

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: nucleoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; zinc ion binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter; blood coagulation

Research Articles on GATA5

Similar Products

Product Notes

The GATA5 gata5 (Catalog #AAA3200522) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GATA5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's GATA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GATA5 gata5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SAATSKAKPS LASPVCPGPS MAPQASGQED DSLAPGHLEF KFEPEDFAFP. It is sometimes possible for the material contained within the vial of "GATA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.