Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-GATA3 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocyteAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit GATA3 Polyclonal Antibody | anti-GATA3 antibody

GATA3 antibody - C-terminal region

Gene Names
GATA3; HDR; HDRS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
GATA3; Polyclonal Antibody; GATA3 antibody - C-terminal region; anti-GATA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS
Sequence Length
444
Applicable Applications for anti-GATA3 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GATA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-GATA3 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocyteAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-GATA3 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocyteAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-GATA3 antibody
This is a rabbit polyclonal antibody against GATA3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GATA3 is crucially involved in IL-5 gene transcription in human peripheral CD4-positive t cells. This gene is involved in growth control and the maintenance of the differentiated state in epithelial cells and may contribute to tumorigenesis in breast cancer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
trans-acting T-cell-specific transcription factor GATA-3 isoform 1
NCBI Official Synonym Full Names
GATA binding protein 3
NCBI Official Symbol
GATA3
NCBI Official Synonym Symbols
HDR; HDRS
NCBI Protein Information
trans-acting T-cell-specific transcription factor GATA-3
UniProt Protein Name
Trans-acting T-cell-specific transcription factor GATA-3
Protein Family
UniProt Gene Name
GATA3
UniProt Entry Name
GATA3_HUMAN

NCBI Description

This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. [provided by RefSeq, Nov 2009]

Research Articles on GATA3

Similar Products

Product Notes

The GATA3 gata3 (Catalog #AAA3201012) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GATA3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's GATA3 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GATA3 gata3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RNRKMSSKSK KCKKVHDSLE DFPKNSSFNP AALSRHMSSL SHISPFSHSS. It is sometimes possible for the material contained within the vial of "GATA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.