Rabbit anti-Human, Pig GALP Polyclonal Antibody | anti-GALP antibody

GALP Antibody

Cat. Num. AAA3249649

• Reactivity: Human, Pig
• Applications: Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: GALP; Polyclonal Antibody; GALP Antibody; Galanin-like peptide; anti-GALP antibody

• Host: Rabbit
• Reactivity: Human, Pig
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
• Sequence: VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP

• Applicable Applications for anti-GALP antibody: Immunohistochemistry (IHC)
• Protein Size: 116 amino acids
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 93%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-GALP antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Related Product Information for anti-GALP antibody

Description of Target: This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, may have vasoactive properties and serve as a marker for neuroblastic tumors.

NCBI and Uniprot Product Information

• NCBI GeneID: 85569
• UniProt Accession #: Q9UBC7; NP_149097
• Molecular Weight: 13kDa
• UniProt Protein Name: Galanin-like peptide
• Protein Family: Galanin-like peptide
• UniProt Gene Name: GALP
• UniProt Entry Name: GALP_HUMAN

Uniprot Description

GALP: Hypothalamic neuropeptide which binds to the G-protein- coupled galanin receptors (GALR1, GALR2 and GALR3). Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin- releasing hormone secretion. Isoform 2 exhibits potent and dose- dependent vasoconstrictor and anti-edema activity in the cutaneous microvasculature, a physiologic effects which does not appear to be mediated via GALR1 or GALR2. Belongs to the galanin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.43

Cellular Component: extracellular region

Molecular Function: hormone activity

Biological Process: neuropeptide signaling pathway; behavioral response to starvation; regulation of appetite; defense response to bacterium; response to insulin stimulus