Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Human Prostate CancerSample Type :Human Prostate CancerPrimary Antibody Dilution :2ug/mLColor/Signal Descriptions:GADD45B (DAB; brown), nuclei (hematoxylin; blue)Gene Name:GADD45B)

Rabbit GADD45B Polyclonal Antibody | anti-GADD45B antibody

GADD45B antibody - middle region

Gene Names
GADD45B; MYD118; GADD45BETA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GADD45B; Polyclonal Antibody; GADD45B antibody - middle region; anti-GADD45B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
Sequence Length
160
Applicable Applications for anti-GADD45B antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GADD45B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Human Prostate CancerSample Type :Human Prostate CancerPrimary Antibody Dilution :2ug/mLColor/Signal Descriptions:GADD45B (DAB; brown), nuclei (hematoxylin; blue)Gene Name:GADD45B)

Immunohistochemistry (IHC) (Sample Type: Human Prostate CancerSample Type :Human Prostate CancerPrimary Antibody Dilution :2ug/mLColor/Signal Descriptions:GADD45B (DAB; brown), nuclei (hematoxylin; blue)Gene Name:GADD45B)
Related Product Information for anti-GADD45B antibody
This is a rabbit polyclonal antibody against GADD45B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of GADD45B is involved in the regulation of growth and apoptosis.This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
growth arrest and DNA damage-inducible protein GADD45 beta
NCBI Official Synonym Full Names
growth arrest and DNA damage inducible beta
NCBI Official Symbol
GADD45B
NCBI Official Synonym Symbols
MYD118; GADD45BETA
NCBI Protein Information
growth arrest and DNA damage-inducible protein GADD45 beta
UniProt Protein Name
Growth arrest and DNA damage-inducible protein GADD45 beta
UniProt Gene Name
GADD45B
UniProt Synonym Gene Names
MYD118
UniProt Entry Name
GA45B_HUMAN

NCBI Description

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq, Jul 2008]

Uniprot Description

GADD45B: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK. Belongs to the GADD45 family.

Protein type: Cell development/differentiation; Apoptosis

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: activation of MAPKK activity; apoptosis; positive regulation of apoptosis; regulation of cell cycle; multicellular organismal development; activation of MAPKKK activity; positive regulation of JNK cascade; negative regulation of protein kinase activity; response to stress; cell differentiation

Research Articles on GADD45B

Similar Products

Product Notes

The GADD45B gadd45b (Catalog #AAA3208977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GADD45B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GADD45B can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GADD45B gadd45b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FCCDNDINIV RVSGMQRLAQ LLGEPAETQG TTEARDLHCL LVTNPHTDAW. It is sometimes possible for the material contained within the vial of "GADD45B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.