Rabbit anti-Mouse FXYD2 Polyclonal Antibody | anti-FXYD2 antibody

FXYD2 Antibody - middle region

Cat. Num. AAA3223739

• Gene Names: Fxyd2; Atp1g1
• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: FXYD2; Polyclonal Antibody; FXYD2 Antibody - middle region; anti-FXYD2 antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: DYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHRQVNEDEL
• Sequence Length: 64

• Applicable Applications for anti-FXYD2 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of Mouse FXYD2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FXYD2Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-FXYD2 antibody

This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The Type III integral membrane protein encoded by this gene is the gamma subunit of the Na,K-ATPase present on the plasma membrane. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzyme's activity by inducing ion channel activity. Multiple transcript variants have been described for this gene that are expressed in tissue-specific and developmental stage-specific patterns and encode proteins that differ at the N-terminus.

Product Categories/Family for anti-FXYD2 antibody

Polyclonal; Ion Channel; Membrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 16554570
• NCBI GeneID: 11936
• NCBI Accession #: NP_031529.2
• NCBI GenBank Nucleotide #: NM_007503.3
• UniProt Accession #: Q04646
• Molecular Weight: 7 kDa
• NCBI Official Full Name: sodium/potassium-transporting ATPase subunit gamma isoform a
• NCBI Official Synonym Full Names: FXYD domain-containing ion transport regulator 2
• NCBI Official Symbol: Fxyd2
• NCBI Official Synonym Symbols: Atp1g1
• NCBI Protein Information: sodium/potassium-transporting ATPase subunit gamma
• UniProt Protein Name: Sodium/potassium-transporting ATPase subunit gamma
• Protein Family: Sodium/potassium-transporting ATPase
• UniProt Gene Name: Fxyd2
• UniProt Synonym Gene Names: Atp1c; Atp1g1; Na(+)/K(+) ATPase subunit gamma
• UniProt Entry Name: ATNG_MOUSE

NCBI Description

This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The Type III integral membrane protein encoded by this gene is the gamma subunit of the Na,K-ATPase present on the plasma membrane. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzyme's activity by inducing ion channel activity. Multiple transcript variants have been described for this gene that are expressed in tissue-specific and developmental stage-specific patterns and encode proteins that differ at the N-terminus. [provided by RefSeq, Sep 2009]

Uniprot Description

FXYD2: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase. Defects in FXYD2 are the cause of hypomagnesemia type 2 (HOMG2); also known as dominant renal hypomagnesemia or hypomagnesemia with hypocalciuria. HOMG2 is a disorder due to primary renal wasting of magnesium. Plasma levels of other electrolytes are normal. The only abnormality found, in addition to low magnesium levels, is lowered renal excretion of calcium resulting in hypocalciuria. Belongs to the FXYD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Cellular Component: membrane; integral to plasma membrane; integral to membrane

Molecular Function: sodium channel regulator activity; ion channel activity

Biological Process: transport; sodium ion transport; ion transport; potassium ion transport