Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: 10ug hFXYD5 transfected 293T lysateLane 2: 10ug 293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:4000Gene Name:FXYD5Submitted by:Anonymous)

Rabbit FXYD5 Polyclonal Antibody | anti-FXYD5 antibody

FXYD5 antibody - N-terminal region

Gene Names
FXYD5; RIC; IWU1; KCT1; OIT2; DYSAD; HSPC113; PRO6241
Reactivity
Tested: Human
Predicted: Human, Mouse, Yeast
Applications
Western Blot
Purity
Protein A purified
Synonyms
FXYD5; Polyclonal Antibody; FXYD5 antibody - N-terminal region; anti-FXYD5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested: Human
Predicted: Human, Mouse, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 0.5-1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD
Sequence Length
178
Applicable Applications for anti-FXYD5 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 100%; Yeast: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FXYD5
Protein Size
178 amino acids
Protein Interactions
UBC
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: 10ug hFXYD5 transfected 293T lysateLane 2: 10ug 293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:4000Gene Name:FXYD5Submitted by:Anonymous)

Western Blot (WB) (Lanes:Lane 1: 10ug hFXYD5 transfected 293T lysateLane 2: 10ug 293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:4000Gene Name:FXYD5Submitted by:Anonymous)

Western Blot (WB)

(WB Suggested Anti-FXYD5 Antibody Titration: 0.625ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-FXYD5 Antibody Titration: 0.625ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-FXYD5 antibody
This is a rabbit polyclonal antibody against FXYD5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIon Channel (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIon Channel) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD5, has not been characterized as a protein.
Product Categories/Family for anti-FXYD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
FXYD domain-containing ion transport regulator 5 isoform 1
NCBI Official Synonym Full Names
FXYD domain containing ion transport regulator 5
NCBI Official Symbol
FXYD5
NCBI Official Synonym Symbols
RIC; IWU1; KCT1; OIT2; DYSAD; HSPC113; PRO6241
NCBI Protein Information
FXYD domain-containing ion transport regulator 5
UniProt Protein Name
FXYD domain-containing ion transport regulator 5
UniProt Gene Name
FXYD5
UniProt Synonym Gene Names
DYSAD; IWU1
UniProt Entry Name
FXYD5_HUMAN

NCBI Description

This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD5, is a glycoprotein that functions in the up-regulation of chemokine production, and it is involved in the reduction of cell adhesion via its ability to down-regulate E-cadherin. It also promotes metastasis, and has been linked to a variety of cancers. Alternative splicing results in multiple transcript variants. [RefSeq curation by Kathleen J. Sweadner, Ph.D., [email protected]., Sep 2009]

Uniprot Description

FXYD5: Involved in down-regulation of E-cadherin which results in reduced cell adhesion. Promotes metastasis. Belongs to the FXYD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Actin-binding; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.12

Cellular Component: integral to membrane

Molecular Function: cadherin binding; ion channel activity; actin binding

Biological Process: microvillus biogenesis; negative regulation of calcium-dependent cell-cell adhesion

Research Articles on FXYD5

Similar Products

Product Notes

The FXYD5 fxyd5 (Catalog #AAA3203708) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FXYD5 antibody - N-terminal region reacts with Tested: Human Predicted: Human, Mouse, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's FXYD5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FXYD5 fxyd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQPTSPTPTW PADETPQPQT QTQQLEGTDG PLVTDPETHK STKAAHPTDD. It is sometimes possible for the material contained within the vial of "FXYD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.