Rabbit anti-Human FUS2 Polyclonal Antibody | anti-FUS2 antibody

FUS2 (NAT6, N-acetyltransferase 6, Protein Fusion-2, Protein Fus-2) (PE)

Cat. Num. AAA6379042

• Gene Names: NAA80; FUS2; NAT6; FUS-2; HsNAAA80
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FUS2; Polyclonal Antibody; FUS2 (NAT6; N-acetyltransferase 6; Protein Fusion-2; Protein Fus-2) (PE); anti-FUS2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NAT6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1218

• Applicable Applications for anti-FUS2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NAT6, aa1-308 (NP_036323.2).
• Immunogen Sequence: MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NAT6 expression in transfected 293T cell line by NAT6 polyclonal antibody. Lane 1: NAT6 transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-FUS2 antibody

Vertebrate FUS2 genes, which are known to be putative tumor suppressor gene, contain several important domains such as the catalytic N-acetyltransferase (NAT) domain. NAT domain is essential enzymes involved in several sophisticated cellular processes such as N-acetylation, O-acetylatin. NAT enzymes may be involved in susceptibility to cancer including colorectal cancer because of the presence of carcinogenic heterocyclic amines in some cooked foods. FUS2 was physically localized to the cytoplasm. Also, FUS2 showed the actin dependent movement, closely related to the polarization in the budding yeast, Saccharomyces cerevisiae.

Product Categories/Family for anti-FUS2 antibody

Antibodies; Enzymes; Acetyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 46048438
• NCBI GeneID: 24142
• NCBI Accession #: NM_012191.2
• NCBI GenBank Nucleotide #: NM_012191.2
• NCBI Official Full Name: Homo sapiens N-acetyltransferase 6 (GCN5-related) (NAT6), mRNA
• NCBI Official Synonym Full Names: N-alpha-acetyltransferase 80, NatH catalytic subunit
• NCBI Official Symbol: NAA80
• NCBI Official Synonym Symbols: FUS2; NAT6; FUS-2; HsNAAA80
• NCBI Protein Information: N-alpha-acetyltransferase 80
• Protein Family: Nuclear fusion protein

NCBI Description

This gene encodes a member of the N-acetyltransferase family. N-acetyltransferases modify proteins by transferring acetyl groups from acetyl CoA to the N-termini of protein substrates. The encoded protein is a cytoplasmic N-acetyltransferase with a substrate specificity for proteins with an N-terminal methionine. This gene is located in the tumor suppressor gene region on chromosome 3p21.3 and the encoded protein may play a role in cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed. This gene overlaps and is on the same strand as hyaluronoglucosaminidase 3, and some transcripts of each gene share a portion of the first exon. [provided by RefSeq, Jan 2011]