Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NAT6 expression in transfected 293T cell line by NAT6 polyclonal antibody. Lane 1: NAT6 transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human FUS2 Polyclonal Antibody | anti-FUS2 antibody

FUS2 (NAT6, N-acetyltransferase 6, Protein Fusion-2, Protein Fus-2) (FITC)

Gene Names
NAA80; FUS2; NAT6; FUS-2; HsNAAA80
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FUS2; Polyclonal Antibody; FUS2 (NAT6; N-acetyltransferase 6; Protein Fusion-2; Protein Fus-2) (FITC); anti-FUS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NAT6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
1218
Applicable Applications for anti-FUS2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NAT6, aa1-308 (NP_036323.2).
Immunogen Sequence
MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NAT6 expression in transfected 293T cell line by NAT6 polyclonal antibody. Lane 1: NAT6 transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NAT6 expression in transfected 293T cell line by NAT6 polyclonal antibody. Lane 1: NAT6 transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FUS2 antibody
Vertebrate FUS2 genes, which are known to be putative tumor suppressor gene, contain several important domains such as the catalytic N-acetyltransferase (NAT) domain. NAT domain is essential enzymes involved in several sophisticated cellular processes such as N-acetylation, O-acetylatin. NAT enzymes may be involved in susceptibility to cancer including colorectal cancer because of the presence of carcinogenic heterocyclic amines in some cooked foods. FUS2 was physically localized to the cytoplasm. Also, FUS2 showed the actin dependent movement, closely related to the polarization in the budding yeast, Saccharomyces cerevisiae.
Product Categories/Family for anti-FUS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens N-acetyltransferase 6 (GCN5-related) (NAT6), mRNA
NCBI Official Synonym Full Names
N-alpha-acetyltransferase 80, NatH catalytic subunit
NCBI Official Symbol
NAA80
NCBI Official Synonym Symbols
FUS2; NAT6; FUS-2; HsNAAA80
NCBI Protein Information
N-alpha-acetyltransferase 80
Protein Family

NCBI Description

This gene encodes a member of the N-acetyltransferase family. N-acetyltransferases modify proteins by transferring acetyl groups from acetyl CoA to the N-termini of protein substrates. The encoded protein is a cytoplasmic N-acetyltransferase with a substrate specificity for proteins with an N-terminal methionine. This gene is located in the tumor suppressor gene region on chromosome 3p21.3 and the encoded protein may play a role in cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed. This gene overlaps and is on the same strand as hyaluronoglucosaminidase 3, and some transcripts of each gene share a portion of the first exon. [provided by RefSeq, Jan 2011]

Research Articles on FUS2

Similar Products

Product Notes

The FUS2 (Catalog #AAA6379035) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FUS2 (NAT6, N-acetyltransferase 6, Protein Fusion-2, Protein Fus-2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FUS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FUS2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FUS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.