Rabbit anti-Human FUS2 Polyclonal Antibody | anti-Nat6 antibody

FUS2 (NAT6, N-acetyltransferase 6, Protein Fusion-2, Protein Fus-2)

Cat. Num. AAA6004284

• Gene Names: Nat6; Fus2; AI225910
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: FUS2; Polyclonal Antibody; FUS2 (NAT6; N-acetyltransferase 6; Protein Fusion-2; Protein Fus-2); Anti -FUS2 (NAT6; anti-Nat6 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NAT6.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI

• Applicable Applications for anti-Nat6 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human NAT6, aa1-308 (NP_036323.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NAT6 expression in transfected 293T cell line by NAT6 polyclonal antibody. Lane 1: NAT6 transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-Nat6 antibody

Vertebrate FUS2 genes, which are known to be putative tumor suppressor gene, contain several important domains such as the catalytic N-acetyltransferase (NAT) domain. NAT domain is essential enzymes involved in several sophisticated cellular processes such as N-acetylation, O-acetylatin. NAT enzymes may be involved in susceptibility to cancer including colorectal cancer because of the presence of carcinogenic heterocyclic amines in some cooked foods. FUS2 was physically localized to the cytoplasm. Also, FUS2 showed the actin dependent movement, closely related to the polarization in the budding yeast, Saccharomyces cerevisiae.

Product Categories/Family for anti-Nat6 antibody

Antibodies; Abs to Enzymes; Acetyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 5714747
• NCBI GeneID: 56441
• UniProt Accession #: Q9R123; Q8QZY5; Q8R014; Q9ERM0
• Molecular Weight: 34,583 Da
• NCBI Official Full Name: FUS2
• NCBI Official Synonym Full Names: N-acetyltransferase 6
• NCBI Official Symbol: Nat6
• NCBI Official Synonym Symbols: Fus2; AI225910
• NCBI Protein Information: N-acetyltransferase 6; fusion 2; protein fus-2; protein fusion-2
• UniProt Protein Name: N-acetyltransferase 6
• Protein Family: N-acetyltransferase
• UniProt Gene Name: Nat6
• UniProt Synonym Gene Names: Fus2; Protein fus-2
• UniProt Entry Name: NAT6_MOUSE

Uniprot Description

NAT6: Seems to be involved in N-acetylation. Acts on peptides with a N-terminal Met followed by Asp/Glu/Asn. May act as a tumor suppressor. Belongs to the acetyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - phenylalanine; Tumor suppressor; Lipid Metabolism - glycerophospholipid; Secondary Metabolites Metabolism - limonene and pinene degradation; Amino Acid Metabolism - tyrosine; EC 2.3.1.-; Acetyltransferase

Cellular Component: cytoplasm

Molecular Function: keto acid formate lyase activity; glucosaminyl-phosphotidylinositol O-acyltransferase activity; S-malonyltransferase activity; 3-hydroxybutyryl-CoA thiolase activity; S-acetyltransferase activity; O-octanoyltransferase activity; O-sinapoyltransferase activity; acyl-CoA N-acyltransferase activity; palmitoleoyl [acyl-carrier-protein]-dependent acyltransferase activity; peptidyl-lysine N6-myristoyltransferase activity; peptidyl-lysine N6-palmitoyltransferase activity; azetidine-2-carboxylic acid acetyltransferase activity; dihydrolipoamide branched chain acyltransferase activity; succinyltransferase activity; Ras palmitoyltransferase activity; palmitoyltransferase activity; C-acyltransferase activity; C-palmitoyltransferase activity; dihydrolipoamide S-acyltransferase activity; protein-cysteine S-acyltransferase activity; N-acetyltransferase activity; serine O-acyltransferase activity; octanoyltransferase activity; O-palmitoyltransferase activity; malonyltransferase activity; O-succinyltransferase activity; sterol O-acyltransferase activity; 3-ketopimelyl-CoA thiolase activity; carnitine O-acyltransferase activity; S-succinyltransferase activity; N-acyltransferase activity; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase activity; N-palmitoyltransferase activity; O-acyltransferase activity; acylglycerol O-acyltransferase activity; O-acetyltransferase activity; benzoyl acetate-CoA thiolase activity; transferase activity; sinapoyltransferase activity; S-acyltransferase activity; protein-cysteine S-myristoyltransferase activity; N-succinyltransferase activity; myristoyltransferase activity; acetyltransferase activity; transferase activity, transferring acyl groups; L-2-aminoadipate N-acetyltransferase activity