Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PLP1 expression in transfected 293T cell line by PLP1 polyclonal antibody. Lane 1: PLP1 transfected lysate (30.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PLP1 Polyclonal Antibody | anti-PLP1 antibody

PLP1 (Myelin Proteolipid Protein, PLP, Lipophilin) APC

Gene Names
PLP1; PLP; PMD; HLD1; MMPL; SPG2; GPM6C; PLP/DM20
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLP1; Polyclonal Antibody; PLP1 (Myelin Proteolipid Protein; PLP; Lipophilin) APC; anti-PLP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PLP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PLP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PLP1, aa1-277 (NP_000524.3).
Immunogen Sequence
MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PLP1 expression in transfected 293T cell line by PLP1 polyclonal antibody. Lane 1: PLP1 transfected lysate (30.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PLP1 expression in transfected 293T cell line by PLP1 polyclonal antibody. Lane 1: PLP1 transfected lysate (30.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PLP1 antibody
PLP encodes the major protein components of compact CNS myelin and mutations in the PLP gene can lead to severe dysmyelinating disease.
Product Categories/Family for anti-PLP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,274 Da
NCBI Official Full Name
myelin proteolipid protein isoform 1
NCBI Official Synonym Full Names
proteolipid protein 1
NCBI Official Symbol
PLP1
NCBI Official Synonym Symbols
PLP; PMD; HLD1; MMPL; SPG2; GPM6C; PLP/DM20
NCBI Protein Information
myelin proteolipid protein
UniProt Protein Name
Myelin proteolipid protein
Protein Family
UniProt Gene Name
PLP1
UniProt Synonym Gene Names
PLP; PLP
UniProt Entry Name
MYPR_HUMAN

NCBI Description

This gene encodes a transmembrane proteolipid protein that is the predominant component of myelin. The encoded protein may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively splicing results in multiple transcript variants, including the DM20 splice variant. [provided by RefSeq, Feb 2015]

Uniprot Description

PLP1: This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. Defects in PLP1 are the cause of leukodystrophy hypomyelinating type 1 (HLD1); also known as Pelizaeus-Merzbacher disease. HLD1 is an X-linked recessive dysmyelinating disorder of the central nervous system in which myelin is not formed properly. It is characterized clinically by nystagmus, spastic quadriplegia, ataxia, and developmental delay. Defects in PLP1 are the cause of spastic paraplegia X- linked type 2 (SPG2). SPG2 is characterized by spastic gait and hyperreflexia. In some patients, complicating features include nystagmus, dysarthria, sensory disturbance, mental retardation, optic atrophy. Belongs to the myelin proteolipid protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: Xq22

Cellular Component: plasma membrane; integral to membrane; myelin sheath

Molecular Function: structural constituent of myelin sheath; structural molecule activity

Biological Process: integrin-mediated signaling pathway; synaptic transmission; substantia nigra development; myelination in the central nervous system; cell maturation; long-chain fatty acid biosynthetic process; axon ensheathment; inflammatory response; astrocyte development

Disease: Spastic Paraplegia 2, X-linked; Pelizaeus-merzbacher Disease

Research Articles on PLP1

Similar Products

Product Notes

The PLP1 plp1 (Catalog #AAA6389846) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLP1 (Myelin Proteolipid Protein, PLP, Lipophilin) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLP1 plp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.