Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Fto Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Brain)

Rabbit Fto Polyclonal Antibody | anti-FTO antibody

Fto antibody - N-terminal region

Gene Names
Fto; AW743446; mKIAA1752
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fto; Polyclonal Antibody; Fto antibody - N-terminal region; anti-FTO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV
Sequence Length
502
Applicable Applications for anti-FTO antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Yeast: 90%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Fto Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Brain)

Western Blot (WB) (WB Suggested Anti-Fto Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Brain)
Related Product Information for anti-FTO antibody
This is a rabbit polyclonal antibody against Fto. It was validated on Western Blot

Target Description: Fto is a dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. Fto has highest activity towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. Fto has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. Fto has no activity towards 1-methylguanine and no detectable activity towards double-stranded DNA. Fto requires molecular oxygen, alpha-ketoglutarate and iron. Fto contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. Fto contributes to the regulation of body size and body fat accumulation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
alpha-ketoglutarate-dependent dioxygenase FTO
NCBI Official Synonym Full Names
fat mass and obesity associated
NCBI Official Symbol
Fto
NCBI Official Synonym Symbols
AW743446; mKIAA1752
NCBI Protein Information
alpha-ketoglutarate-dependent dioxygenase FTO
UniProt Protein Name
Alpha-ketoglutarate-dependent dioxygenase FTO
UniProt Gene Name
Fto
UniProt Synonym Gene Names
Kiaa1752
UniProt Entry Name
FTO_MOUSE

Uniprot Description

FTO: Dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. Has highest activity towards single- stranded RNA containing 3-methyluracil, followed by single- stranded DNA containing 3-methylthymine. Has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. Has no activity towards 1-methylguanine. Has no detectable activity towards double-stranded DNA. Requires molecular oxygen, alpha-ketoglutarate and iron. Contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. Contributes to the regulation of body size and body fat accumulation. Defects in FTO are the cause of growth retardation developmental delay coarse facies and early death (GDFD). A severe polymalformation syndrome characterized by postnatal growth retardation, microcephaly, severe psychomotor delay, functional brain deficits and characteristic facial dysmorphism. In some patients, structural brain malformations, cardiac defects, genital anomalies, and cleft palate are observed. Early death occurs by the age of 3 years. Belongs to the fto family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.14.11.-

Cellular Component: nuclear speck; nucleus

Molecular Function: procollagen-proline dioxygenase activity; 2,4-dichlorophenoxyacetate alpha-ketoglutarate dioxygenase activity; sulfonate dioxygenase activity; dioxygenase activity; ferrous iron binding; metal ion binding; DNA-N1-methyladenine dioxygenase activity; oxidoreductase activity

Biological Process: DNA dealkylation; RNA repair; regulation of multicellular organism growth; thermoregulation; DNA repair; response to DNA damage stimulus

Research Articles on FTO

Similar Products

Product Notes

The FTO fto (Catalog #AAA3208592) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fto antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's Fto can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FTO fto for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKRVQTAEER EREAKKLRLL EELEDTWLPY LTPKDDEFYQ QWQLKYPKLV. It is sometimes possible for the material contained within the vial of "Fto, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.