Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ALKB2 antibody Titration: 1 ug/mLSample Type: Human OVCAR-3 Whole Cell)

Rabbit ALKBH2 Polyclonal Antibody | anti-ALKBH2 antibody

ALKBH2 Antibody - C-terminal region

Gene Names
ALKBH2; ABH2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
ALKBH2; Polyclonal Antibody; ALKBH2 Antibody - C-terminal region; anti-ALKBH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGAC
Sequence Length
261
Applicable Applications for anti-ALKBH2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen for Anti-ALKBH2 antibody is: synthetic peptide directed towards the C-terminal region of Human ALKB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ALKB2 antibody Titration: 1 ug/mLSample Type: Human OVCAR-3 Whole Cell)

Western Blot (WB) (WB Suggested Anti-ALKB2 antibody Titration: 1 ug/mLSample Type: Human OVCAR-3 Whole Cell)
Related Product Information for anti-ALKBH2 antibody
This is a rabbit polyclonal antibody against ALKB2. It was validated on Western Blot

Target Description: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-ALKBH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
28 kDa
NCBI Official Full Name
DNA oxidative demethylase ALKBH2
NCBI Official Synonym Full Names
alkB homolog 2, alpha-ketoglutarate dependent dioxygenase
NCBI Official Symbol
ALKBH2
NCBI Official Synonym Symbols
ABH2
NCBI Protein Information
DNA oxidative demethylase ALKBH2
UniProt Protein Name
Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
Protein Family
UniProt Gene Name
ALKBH2
UniProt Synonym Gene Names
ABH2
UniProt Entry Name
ALKB2_HUMAN

NCBI Description

The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008]

Uniprot Description

ALKBH2: Dioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Can also repair alkylated DNA containing 1- ethenoadenine (in vitro). Has strong preference for double- stranded DNA. Has low efficiency with single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron. Belongs to the alkB family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA repair, damage; EC 1.14.11.33; Oxidoreductase; Hydrolase; Demethylase

Chromosomal Location of Human Ortholog: 12q24.11

Cellular Component: microtubule cytoskeleton; nucleoplasm; nucleus

Molecular Function: ferrous iron binding; DNA-N1-methyladenine dioxygenase activity; DNA demethylase activity

Biological Process: DNA dealkylation; DNA repair

Research Articles on ALKBH2

Similar Products

Product Notes

The ALKBH2 alkbh2 (Catalog #AAA3210430) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALKBH2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ALKBH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALKBH2 alkbh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DHVSGVTGQT FNFVLINRYK DGCDHIGEHR DDERELAPGS PIASVSFGAC. It is sometimes possible for the material contained within the vial of "ALKBH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.