Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MRE11A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)

Rabbit MRE11 Polyclonal Antibody | anti-MRE11 antibody

MRE11 Antibody - middle region

Gene Names
MRE11; ATLD; HNGS1; MRE11A; MRE11B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRE11; Polyclonal Antibody; MRE11 Antibody - middle region; anti-MRE11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAE
Sequence Length
708
Applicable Applications for anti-MRE11 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MRE11A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MRE11A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-MRE11A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)
Related Product Information for anti-MRE11 antibody
This is a rabbit polyclonal antibody against MRE11A. It was validated on Western Blot

Target Description: This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
double-strand break repair protein MRE11 isoform 1
NCBI Official Synonym Full Names
MRE11 homolog, double strand break repair nuclease
NCBI Official Symbol
MRE11
NCBI Official Synonym Symbols
ATLD; HNGS1; MRE11A; MRE11B
NCBI Protein Information
double-strand break repair protein MRE11
UniProt Protein Name
Double-strand break repair protein MRE11A
UniProt Gene Name
MRE11A
UniProt Synonym Gene Names
HNGS1; MRE11; MRE11 homolog 1
UniProt Entry Name
MRE11_HUMAN

NCBI Description

This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

MRE11A: a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. Alternative splicing results in two different isoforms.

Protein type: Cell cycle regulation; DNA-binding; Deoxyribonuclease; DNA repair, damage

Chromosomal Location of Human Ortholog: 11q21

Cellular Component: nucleoplasm; chromosome, telomeric region; Mre11 complex; cytosol; chromatin; nucleus

Molecular Function: protein C-terminus binding; ATP-dependent DNA helicase activity; protein binding; nuclease activity; DNA binding; single-stranded DNA specific endodeoxyribonuclease activity; manganese ion binding; endonuclease activity; double-stranded DNA binding; 3'-5' exonuclease activity; endodeoxyribonuclease activity

Biological Process: sister chromatid cohesion; positive regulation of kinase activity; negative regulation of DNA endoreduplication; telomere maintenance via telomerase; DNA repair; regulation of mitotic recombination; DNA catabolic process, endonucleolytic; positive regulation of protein amino acid autophosphorylation; DNA duplex unwinding; double-strand break repair via homologous recombination; double-strand break repair via nonhomologous end joining; DNA recombination; cell proliferation; base-excision repair; nucleotide-excision repair; intra-S DNA damage checkpoint; meiotic recombination; mitotic cell cycle G2/M transition DNA damage checkpoint; double-strand break repair; synapsis; positive regulation of interferon type I production; innate immune response; response to DNA damage stimulus; telomere maintenance

Disease: Ataxia-telangiectasia-like Disorder 1

Research Articles on MRE11

Similar Products

Product Notes

The MRE11 mre11a (Catalog #AAA3212899) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRE11 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MRE11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRE11 mre11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFRETRQKNT NEEDDEVREA MTRARALRSQ SEESASAFSA DDLMSIDLAE. It is sometimes possible for the material contained within the vial of "MRE11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.