Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen using MBS609209 (35.97kD) .)

Mouse anti-Human FOLR2 Monoclonal Antibody | anti-FOLR2 antibody

FOLR2 (Folate Receptor beta, FR-beta, Folate Receptor 2 Folate Receptor, Fetal/Placental Placental Folate-binding Protein, FBP)

Gene Names
FOLR2; FBP; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
FOLR2; Monoclonal Antibody; FOLR2 (Folate Receptor beta; FR-beta; Folate Receptor 2 Folate Receptor; Fetal/Placental Placental Folate-binding Protein; FBP); Anti -FOLR2 (Folate Receptor beta; anti-FOLR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B12
Specificity
Recognizes human FOLR2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.4
Concentration
0.43mg/ml (varies by lot)
Sequence
HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQTWRKERFLDVPL*
Applicable Applications for anti-FOLR2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detetion limit for recombinant GST tagged FOLR2 is ~1ng/ml using MBS609209 as a capture antibody.
Western Blot: Detects a band at ~36.34kD using immunogen protein lysate.

Optimal dilutions to be determined by the researcher.
Immunogen
Recombinant protein corresponding to aa36-128 from FOLR2 with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen using MBS609209 (35.97kD) .)

Western Blot (WB) (Western Blot detection against Immunogen using MBS609209 (35.97kD) .)

Testing Data

(Detection limit for recombinant GST tagged FOLR2 is approximately 1ng/ml using MBS609209 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FOLR2 is approximately 1ng/ml using MBS609209 as a capture antibody.)
Related Product Information for anti-FOLR2 antibody
The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene.
Product Categories/Family for anti-FOLR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,280 Da
NCBI Official Full Name
folate receptor beta
NCBI Official Synonym Full Names
folate receptor 2 (fetal)
NCBI Official Symbol
FOLR2
NCBI Official Synonym Symbols
FBP; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1
NCBI Protein Information
folate receptor beta; folate receptor, beta; folate receptor, fetal/placental; placental folate-binding protein; folate-binding protein, fetal/placental
UniProt Protein Name
Folate receptor beta
Protein Family
UniProt Gene Name
FOLR2
UniProt Synonym Gene Names
FR-beta; FBP
UniProt Entry Name
FOLR2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

FOLR2: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Belongs to the folate receptor family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 11q13.3-q13.5

Cellular Component: anchored to external side of plasma membrane; membrane; extracellular region

Molecular Function: folic acid transporter activity; folic acid binding

Biological Process: folic acid transport

Research Articles on FOLR2

Similar Products

Product Notes

The FOLR2 folr2 (Catalog #AAA609209) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FOLR2 (Folate Receptor beta, FR-beta, Folate Receptor 2 Folate Receptor, Fetal/Placental Placental Folate-binding Protein, FBP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOLR2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Sandwich ELISA: The detetion limit for recombinant GST tagged FOLR2 is ~1ng/ml using MBS609209 as a capture antibody. Western Blot: Detects a band at ~36.34kD using immunogen protein lysate. Optimal dilutions to be determined by the researcher. Researchers should empirically determine the suitability of the FOLR2 folr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HHKTKPGPED KLHDQCSPWK KNACCTASTS QELHKDTSRL YNFNWDHCGK MEPACKRHFI QDTCLYECSP NLGPWIQQVN QTWRKERFLD VPL*. It is sometimes possible for the material contained within the vial of "FOLR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.