Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FLT3Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human FLT3 Polyclonal Antibody | anti-FLT3 antibody

FLT3 Antibody - N-terminal region

Gene Names
FLT3; FLK2; STK1; CD135; FLK-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FLT3; Polyclonal Antibody; FLT3 Antibody - N-terminal region; anti-FLT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQS
Sequence Length
952
Applicable Applications for anti-FLT3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FLT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FLT3Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FLT3Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FLT3 antibody
This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. This receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
108 kDa
NCBI Official Full Name
receptor-type tyrosine-protein kinase FLT3
NCBI Official Synonym Full Names
fms related tyrosine kinase 3
NCBI Official Symbol
FLT3
NCBI Official Synonym Symbols
FLK2; STK1; CD135; FLK-2
NCBI Protein Information
receptor-type tyrosine-protein kinase FLT3
UniProt Protein Name
Receptor-type tyrosine-protein kinase FLT3
UniProt Gene Name
FLT3
UniProt Synonym Gene Names
CD135; FLK2; STK1; FLK-2; FLT-3; STK-1
UniProt Entry Name
FLT3_HUMAN

NCBI Description

This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. This receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia. [provided by RefSeq, Jan 2015]

Uniprot Description

FLT3: a receptor tyrosine kinase of the PDGFR family that binds the FL cytokine. FLT3 -/- mice have an impaired developmental capacity of primitive hematopoietic progenitor cells of all lineages with the greatest impact on lymphopoietic precursors. Activating mutations found in one third of cases of acute myeloid leukemia (AML), as well as in acute lymphoblastic leukemia, acute promyelocytic leukemia and myelodysplastic syndrome. Inhibitors: Sutent and PKC412.

Protein type: Kinase, protein; Membrane protein, integral; EC 2.7.10.1; Oncoprotein; Protein kinase, TK; Protein kinase, tyrosine (receptor); TK group; PDGFR family

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: protein complex; integral to plasma membrane; endoplasmic reticulum lumen; cytosol; nucleus; external side of plasma membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; vascular endothelial growth factor receptor activity; protein binding; protein homodimerization activity; protein complex binding; phosphoinositide 3-kinase binding; transmembrane receptor protein tyrosine kinase activity; ATP binding; glucocorticoid receptor binding

Biological Process: negative regulation of B cell differentiation; lymphocyte proliferation; pro-B cell differentiation; organ regeneration; peptidyl-tyrosine phosphorylation; protein amino acid autophosphorylation; cytokine and chemokine mediated signaling pathway; positive regulation of phosphoinositide 3-kinase activity; response to organic nitrogen; positive regulation of phosphoinositide 3-kinase cascade; regulation of apoptosis; negative regulation of cell proliferation; positive regulation of MAP kinase activity; positive regulation of tyrosine phosphorylation of STAT protein; myeloid progenitor cell differentiation; positive regulation of MAPKKK cascade; B cell differentiation; positive regulation of cell proliferation; hemopoiesis; pro-T cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; leukocyte homeostasis

Disease: Leukemia, Acute Lymphoblastic

Research Articles on FLT3

Similar Products

Product Notes

The FLT3 flt3 (Catalog #AAA3221215) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FLT3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FLT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FLT3 flt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGTITNQDLP VIKCVLINHK NNDSSVGKSS SYPMVSESPE DLGCALRPQS. It is sometimes possible for the material contained within the vial of "FLT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.